Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetN-lysine methyltransferase SMYD2
LigandBDBM378778
Substrate/Competitorn/a
Meas. Tech.SMYD2 Biochemical Assay
IC50 1300±n/a nM
Citation Foley, MAKuntz, KWMills, JEMitchell, LHMunchhof, MJHarvey, DM Substituted 1,2,3-triazoles as SMYD inhibitors for treating cancer US Patent US10266526 Publication Date 4/23/2019
More Info.:Get all data from this article,  Assay Method
 
N-lysine methyltransferase SMYD2
Name:N-lysine methyltransferase SMYD2
Synonyms:HSKM-B | Histone methyltransferase SMYD2 | KMT3C | Lysine N-methyltransferase 3C | N-lysine methyltransferase SMYD2 | SET and MYND domain-containing protein 2 | SMYD2
Type:Enzyme
Mol. Mass.:49689.57
Organism:Homo sapiens (Human)
Description:Q9NRG4
Residue:433
Sequence:
MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKE
GLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHP
ERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVN
CNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSY
IDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARN
VIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGAL
QYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDH
PYISEIKQEIESH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM378778
NameBDBM378778
Synonyms:4-cyclopropyl-N-(1-isopropylazetidin-3-yl)picolinamide | US10266526, Compound 961
TypeSmall organic molecule
Emp. Form.C15H21N3O
Mol. Mass.259.3467
SMILESCC(C)N1CC(C1)NC(=O)c1cc(ccn1)C1CC1
Structure
n/a