Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProto-oncogene tyrosine-protein kinase LCK
LigandBDBM26166
Substrate/CompetitorBiotinylated Peptide Substrate
Meas. Tech.Time Resolved Fluorescence Resonance Energy Transfer Assay
pH7.4±n/a
Temperature295.15±n/a K
IC50 8.5±n/a nM
Citation Bamborough, PAngell, RMBhamra, IBrown, DBull, JChristopher, JACooper, AWFazal, LHGiordano, IHind, LPatel, VKRanshaw, LESims, MJSkone, PASmith, KJVickerstaff, EWashington, M N-4-Pyrimidinyl-1H-indazol-4-amine inhibitors of Lck: indazoles as phenol isosteres with improved pharmacokinetics. Bioorg Med Chem Lett17:4363-8 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Proto-oncogene tyrosine-protein kinase LCK
Name:Proto-oncogene tyrosine-protein kinase LCK
Synonyms:LSK | Lck | Lymphocyte cell-specific protein-tyrosine kinase | Proto-oncogene tyrosine-protein kinase LCK | Tyrosine-protein kinase LCK | p56-LCK
Type:PROTEIN
Mol. Mass.:57927.84
Organism:Mus musculus
Description:ChEMBL_806408
Residue:509
Sequence:
MGCVCSSNPEDDWMENIDVCENCHYPIVPLDSKISLPIRNGSEVRDPLVTYEGSLPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHDLVRHYTNASDGLCTKLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHPRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLNVNKLLDMAAQIAEGMAFIEEQNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYHLMMLCWKER
PEDRPTFDYLRSVLDDFFTATEGQYQPQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26166
NameBDBM26166
Synonyms:2,4-dianilino pyrimidine, 23 | 3-({4-[(5-hydroxy-2-methylphenyl)amino]pyrimidin-2-yl}amino)benzene-1-sulfonamide
TypeSmall organic molecule
Emp. Form.C17H17N5O3S
Mol. Mass.371.414
SMILESCc1ccc(O)cc1Nc1ccnc(Nc2cccc(c2)S(N)(=O)=O)n1
Structure
Biotinylated Peptide Substrate
Name:Biotinylated Peptide Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:1622.70
Organism:n/a
Description:n/a
Residue:13
Sequence:
Biotin-EEEEYFELV