Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target17-beta-Hydroxysteroid Dehydrogenase 5 (17-beta-HSD5, AKR1C3)
LigandBDBM26269
Substrate/CompetitorBDBM26271
Meas. Tech.Assay of Enzyme Activity
pH7.4±n/a
Temperature298.15±n/a K
Ki 94000±1300 nM
Citation Dhagat, UEndo, SSumii, RHara, AEl-Kabbani, O Selectivity determinants of inhibitor binding to human 20alpha-hydroxysteroid dehydrogenase: crystal structure of the enzyme in ternary complex with coenzyme and the potent inhibitor 3,5-dichlorosalicylic acid. J Med Chem51:4844-8 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
17-beta-Hydroxysteroid Dehydrogenase 5 (17-beta-HSD5, AKR1C3)
Name:Aldo-keto-reductase family 1 member C3
Synonyms:3-alpha-HSD type 2 | Aldo-keto reductase family 1 member C3 | Aldo-keto reductase family 1 member C3 (AK1C3) | Aldo-keto reductase family 1 member C3 (AK1C3a) | Aldo-keto reductase family 1 member C3 (AKR1C3) | Dihydrodiol dehydrogenase 3 | Dihydrodiol dehydrogenase type I | Estradiol 17-beta-dehydrogenase | Prostaglandin F synthase | Testosterone 17-beta-dehydrogenase 5 | Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
Type:Enzyme
Mol. Mass.:36859.86
Organism:Homo sapiens (human)
Description:P42330
Residue:323
Sequence:
MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPM
SLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
RNLHYFNSDSFASHPNYPYSDEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26269
NameBDBM26269
Synonyms:3,5-dichloro-2-hydroxybenzoic acid | 3,5-dichlorosalicylic acid | CHEMBL449129
TypeSmall organic molecule
Emp. Form.C7H4Cl2O3
Mol. Mass.207.011
SMILESOC(=O)c1cc(Cl)cc(Cl)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM26271
NameBDBM26271
Synonyms:(1S)-1,2,3,4-tetrahydronaphthalen-1-ol | CHEMBL206199 | S-(+)-1,2,3,4-tetrahydro-1-naphthol | S-tetralol
TypeSmall organic molecule
Emp. Form.C10H12O
Mol. Mass.148.2017
SMILESO[C@H]1CCCc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: