Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAurora kinase B/Inner centromere protein
LigandBDBM26284
Substrate/CompetitorBiotinylated Peptide Substrate
Meas. Tech.Aurora B Kinase Inhibition Assay
pH7.5±n/a
Temperature295.15±n/a K
Ki 1±n/a nM
Citation Mortlock, AAFoote, KMHeron, NMJung, FHPasquet, GLohmann, JJWarin, NRenaud, FDe Savi, CRoberts, NJJohnson, TDousson, CBHill, GBPerkins, DHatter, GWilkinson, RWWedge, SRHeaton, SPOdedra, RKeen, NJCrafter, CBrown, EThompson, KBrightwell, SKhatri, LBrady, MCKearney, SMcKillop, DRhead, SParry, TGreen, S Discovery, synthesis, and in vivo activity of a new class of pyrazoloquinazolines as selective inhibitors of aurora B kinase. J Med Chem50:2213-24 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Aurora kinase B/Inner centromere protein
Name:Aurora kinase A/B
Synonyms:AIM-1 | Aurora B kinase (aurB) | Aurora B-INCENP | Aurora kinase 2 | Aurora kinase B | Aurora kinase B (AURKB) | Aurora-related kinase 2 | STK-1 | Serine/threonine-protein kinase aurora B
Type:Protein
Mol. Mass.:39327.72
Organism:Homo sapiens (Human)
Description:Q96GD4
Residue:344
Sequence:
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26284
Biotinylated Peptide Substrate
Name:Biotinylated Peptide Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:2374.22
Organism:n/a
Description:n/a
Residue:20
Sequence:
biotinyl-Ahx-tetra(LRRWSLG)