Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAurora kinase B/Inner centromere protein
LigandBDBM26292
Substrate/CompetitorBiotinylated Peptide Substrate
Meas. Tech.Aurora B Kinase Inhibition Assay
pH7.5±n/a
Temperature295.15±n/a K
Ki 1±n/a nM
Citation Mortlock, AAFoote, KMHeron, NMJung, FHPasquet, GLohmann, JJWarin, NRenaud, FDe Savi, CRoberts, NJJohnson, TDousson, CBHill, GBPerkins, DHatter, GWilkinson, RWWedge, SRHeaton, SPOdedra, RKeen, NJCrafter, CBrown, EThompson, KBrightwell, SKhatri, LBrady, MCKearney, SMcKillop, DRhead, SParry, TGreen, S Discovery, synthesis, and in vivo activity of a new class of pyrazoloquinazolines as selective inhibitors of aurora B kinase. J Med Chem50:2213-24 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Aurora kinase B/Inner centromere protein
Name:Aurora kinase A/B
Synonyms:AIM-1 | Aurora B kinase (aurB) | Aurora B-INCENP | Aurora kinase 2 | Aurora kinase B | Aurora kinase B (AURKB) | Aurora-related kinase 2 | STK-1 | Serine/threonine-protein kinase aurora B
Type:Protein
Mol. Mass.:39327.72
Organism:Homo sapiens (Human)
Description:Q96GD4
Residue:344
Sequence:
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26292
NameBDBM26292
Synonyms:2-{3-[(7-{3-[ethyl(2-hydroxyethyl)amino]propoxy}-6-methoxyquinazolin-4-yl)amino]-1H-pyrazol-5-yl}-N-(3-fluorophenyl)acetamide | CHEMBL215275 | pyrazoloquinazoline deriv., 26
TypeSmall organic molecule
Emp. Form.C27H32FN7O4
Mol. Mass.537.5859
SMILESCCN(CCO)CCCOc1cc2ncnc(Nc3cc(CC(=O)Nc4cccc(F)c4)n[nH]3)c2cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
Biotinylated Peptide Substrate
Name:Biotinylated Peptide Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:2374.22
Organism:n/a
Description:n/a
Residue:20
Sequence:
biotinyl-Ahx-tetra(LRRWSLG)