Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTNF-alpha-Converting Enzyme
LigandBDBM26550
Substrate/CompetitorTACE Substrate Peptide
Meas. Tech.TACE Inhibition Assay
pH7.5±n/a
Temperature295.15±n/a K
Ki 10±n/a nM
Citation Bandarage, UKWang, TCome, JHPerola, EWei, YRao, BG Novel thiol-based TACE inhibitors. Part 2: Rational design, synthesis, and SAR of thiol-containing aryl sulfones. Bioorg Med Chem Lett18:44-8 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
TNF-alpha-Converting Enzyme
Name:TNF-alpha-Converting Enzyme
Synonyms:A disintegrin and metalloproteinase domain 17 | ADAM 17 | CD156b antigen | Snake venom-like protease
Type:Single-pass type I membrane protein; metalloprotease
Mol. Mass.:29695.98
Organism:Homo sapiens (human)
Description:The catalytic domain of recombinant human TNF-converting enzyme (residues 215-477) with two mutations (S266A and N452Q) and a 6xHis was purified from the baculovirus/Hi5 cells expression system.
Residue:263
Sequence:
RADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTAWDNAGFKG
YGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCL
AHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTI
LTKEADLVTTHELGHNFGAEHDPDGLAECAPNEDQGGKYVMYPIAVSGDHENNKMFSQCS
KQSIYKTIESKAQECFQERSNKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26550
NameBDBM26550
Synonyms:2-{[4-(but-2-yn-1-yloxy)benzene](methyl)sulfonamido}-N-hydroxyacetamide | BMCL1844 Compound 1 | CHEMBL321556 | butynyloxy containing compound, 1
TypeSmall organic molecule
Emp. Form.C13H16N2O5S
Mol. Mass.312.342
SMILESCC#CCOc1ccc(cc1)S(=O)(=O)N(C)CC(=O)NO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
TACE Substrate Peptide
Name:TACE Substrate Peptide
Synonyms:Bachem M-2155 | DABCYL-TNF-alpha-EDANS (-4 to +6) (human)
Type:Internally quenched peptide
Mol. Mass.:4104.44
Organism:n/a
Description:n/a
Residue:39
Sequence:
DABCYL-Leu-Ala-Gln-Ala-Val-Arg-Ser-Ser-Ser-Arg-EDANS