Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase pim-1
LigandBDBM26656
Substrate/CompetitorGST-BAD
Meas. Tech.Solid-Phase ELISA Kinase Assay
pH7±n/a
Temperature303.15±n/a K
IC50 650±n/a nM
Citation Holder, SZemskova, MZhang, CTabrizizad, MBremer, RNeidigh, JWLilly, MB Characterization of a potent and selective small-molecule inhibitor of the PIM1 kinase. Mol Cancer Ther6:163-72 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Serine/threonine-protein kinase pim-1
Name:Serine/threonine-protein kinase PIM
Synonyms:PIM-1 Kinase | PIM1 | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1)
Type:Protein
Mol. Mass.:35681.82
Organism:Homo sapiens (Human)
Description:P11309
Residue:313
Sequence:
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26656
NameBDBM26656
Synonyms:5,7,3,4,5-pentahydroxyflavone | 5,7-dihydroxy-2-(3,4,5-trihydroxyphenyl)-4H-chromen-4-one
TypeFlavonoid
Emp. Form.C15H10O7
Mol. Mass.302.2357
SMILESOc1cc(O)c2c(c1)oc(cc2=O)-c1cc(O)c(O)c(O)c1
Structure
GST-BAD
Name:GST-BAD
Synonyms:GST fusion protein of Bcl2 antagonist of cell death
Type:Other Protein Type
Mol. Mass.:22084.58
Organism:Mus musculus (mouse)
Description:n/a
Residue:204
Sequence:
MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASAT
DRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEED
EGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQS
AGWTRIIQSWWDRNLGKGGSTPSQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: