Reaction Details |
 | Report a problem with these data |
Target | C-C motif chemokine 4 |
---|
Ligand | BDBM65456 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | cytomteric bead array (CBA) assay |
---|
IC50 | >10000±n/a nM |
---|
Citation | Gandhi, A; Dimartino, J; Chopra, R Methods for the treatment of locally advanced breast cancer US Patent US9694015 Publication Date 7/4/2017 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
C-C motif chemokine 4 |
---|
Name: | C-C motif chemokine 4 |
Synonyms: | ACT-2 | G-26 T-lymphocyte-secreted protein | HC21 | LAG-1 | Lymphocyte activation gene 1 protein | MIP-1-beta | Macrophage inflammatory protein 1-beta | PAT 744 | Protein H400 | SIS-gamma | Small-inducible cytokine A4 | T-cell activation protein 2 |
Type: | Protein |
Mol. Mass.: | 10210.74 |
Organism: | Human |
Description: | P13236 |
Residue: | 92 |
Sequence: | MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ
PAVVFQTKRSKQVCADPSESWVQEYVYDLELN
|
|
|
BDBM65456 |
---|
Name | BDBM65456 |
Synonyms: | 19171-19-8 | 4-amino-2-(2,6-dioxopiperidin-3-yl)isoindoline-1,3-dione | Actimid | CC-4047 | Pomalyst | US9694015, 6.2 | pomalidomide |
Type | Small organic molecule |
Emp. Form. | C13H11N3O4 |
Mol. Mass. | 273.2441 |
SMILES | Nc1cccc2C(=O)N(C3CCC(=O)NC3=O)C(=O)c12 |
Structure |
|
n/a |
---|