Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C motif chemokine 4
LigandBDBM65456
Substrate/Competitorn/a
Meas. Tech.cytomteric bead array (CBA) assay
IC50>10000±n/a nM
Citation Gandhi, ADimartino, JChopra, R Methods for the treatment of locally advanced breast cancer US Patent US9694015 Publication Date 7/4/2017
More Info.:Get all data from this article,  Assay Method
 
C-C motif chemokine 4
Name:C-C motif chemokine 4
Synonyms:ACT-2 | G-26 T-lymphocyte-secreted protein | HC21 | LAG-1 | Lymphocyte activation gene 1 protein | MIP-1-beta | Macrophage inflammatory protein 1-beta | PAT 744 | Protein H400 | SIS-gamma | Small-inducible cytokine A4 | T-cell activation protein 2
Type:Protein
Mol. Mass.:10210.74
Organism:Human
Description:P13236
Residue:92
Sequence:
MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ
PAVVFQTKRSKQVCADPSESWVQEYVYDLELN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM65456
n/a
NameBDBM65456
Synonyms:19171-19-8 | 4-amino-2-(2,6-dioxopiperidin-3-yl)isoindoline-1,3-dione | Actimid | CC-4047 | Pomalyst | US9694015, 6.2 | pomalidomide
TypeSmall organic molecule
Emp. Form.C13H11N3O4
Mol. Mass.273.2441
SMILESNc1cccc2C(=O)N(C3CCC(=O)NC3=O)C(=O)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: