Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine oxidase type A (MAO-A)
LigandBDBM29138
Substrate/CompetitorBDBM29135
Meas. Tech.MAO Enzyme Inhibition Assay
Citation Chimenti, FFioravanti, RBolasco, AChimenti, PSecci, DRossi, FYáñez, MOrallo, FOrtuso, FAlcaro, S Chalcones: a valid scaffold for monoamine oxidases inhibitors. J Med Chem52:2818-24 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Monoamine oxidase type A (MAO-A)
Name:Monoamine oxidase
Synonyms:Amine oxidase (flavin-containing) A | Amine oxidase [flavin-containing] A | MAO-A | Monoamine oxidase | Monoamine oxidase type A | Monoamine oxidase type A (MAO A) | Monoamine oxidase type A (MAO A) | Monoamine oxidase type A (MAOA)
Type:Protein
Mol. Mass.:59689.53
Organism:Homo sapiens (Human)
Description:P21397
Residue:527
Sequence:
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV
DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL
NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR
LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD
VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM29138
BDBM29135
NameBDBM29138
Synonyms:substituted chalcone, 5b
TypeSmall organic molecule
Emp. Form.C21H22O3
Mol. Mass.322.3976
SMILES[#6]\[#6](-[#6])=[#6]\[#6]-[#8]-c1ccc(-[#6](=O)\[#6]=[#6]\c2ccc(-[#6])cc2)c(-[#8])c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: