Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaspase-7
LigandBDBM10246
Substrate/CompetitorCaspase-7 Substrate
Meas. Tech.Enzyme Inhibition Assay
IC50 2.95±n/a nM
Citation Chu, WRothfuss, JChu, YZhou, DMach, RH Synthesis and in vitro evaluation of sulfonamide isatin Michael acceptors as small molecule inhibitors of caspase-6. J Med Chem52:2188-91 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Caspase-7
Name:Caspase-7
Synonyms:Apoptotic protease Mch-3 | CASP-7 | CMH-1 | caspase 7, apoptosis-related cysteine peptidase
Type:Enzyme
Mol. Mass.:34273.91
Organism:Homo sapiens (human)
Description:P55210
Residue:303
Sequence:
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQY
NMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQ
DLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSW
FVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELY
FSQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10246
Caspase-7 Substrate
Name:Caspase-7 Substrate
Synonyms:N-Acetyl-Asp-Glu-Val-Asp-7-amido-4-methylcoumarin
Type:Fluorogenic Substrate
Mol. Mass.:953.05
Organism:n/a
Description:n/a
Residue:9
Sequence:
Ac-DEVD-AMC