| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HIV-1 Protease |
|---|
| Ligand | BDBM558 |
|---|
| Substrate/Competitor | Peptide Substrate |
|---|
| Meas. Tech. | Protease Inhibition Assay |
|---|
| pH | 5±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| Ki | 0.008±n/a nM |
|---|
| Citation |  Thaisrivongs, S; Skulnick, HI; Turner, SR; Strohbach, JW; Tommasi, RA; Johnson, PD; Aristoff, PA; Judge, TM; Gammill, RB; Morris, JK; Romines, KR; Chrusciel, RA; Hinshaw, RR; Chong, KT; Tarpley, WG; Poppe, SM; Slade, DE; Lynn, JC; Horng, MM; Tomich, PK; Seest, EP; Dolak, LA; Howe, WJ; Howard, GM; Watenpaugh, KD Structure-based design of HIV protease inhibitors: sulfonamide-containing 5,6-dihydro-4-hydroxy-2-pyrones as non-peptidic inhibitors. J Med Chem39:4349-53 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| HIV-1 Protease |
|---|
| Name: | HIV-1 Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Tandem linked enzyme construct |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Human immunodeficiency virus type 1 protease |
|---|
| Synonyms: | Pol polyprotein |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| Component 2 |
| Name: | Human immunodeficiency virus type 1 protease |
|---|
| Synonyms: | Pol polyprotein |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM558 |
|---|
| Name | BDBM558 |
|---|
| Synonyms: | N-{3-[(1R)-1-[(6R)-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-5,6-dihydro-2H-pyran-3-yl]propyl]phenyl}-5-(trifluoromethyl)pyridine-2-sulfonamide | PNU-140690 | Sulfonamide-Containing 5,6-Dihydro-4-hydroxy-2-pyrones | Tipranavir | U-140690 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | n/a |
|---|
| Mol. Mass. | n/a |
|---|
| SMILES | n/a |
|---|
| Structure |  |
|---|
| Peptide Substrate |
|---|
| Name: | Peptide Substrate |
|---|
| Synonyms: | n/a |
|---|
| Type: | Peptide |
|---|
| Mol. Mass.: | 1447.64 |
|---|
| Organism: | n/a |
|---|
| Description: | The peptide was derivatized with biotin and
fluorescein isothiocyanate at the amino and carboxy termini. |
|---|
| Residue: | 12 |
|---|
| Sequence: | |
|---|
Search and Browse
