BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRunt-Related Transcription Factor 1 Isoform AML1C
LigandBDBM29688
Substrate/CompetitorVenus-CBFbeta-SMMHC
Meas. Tech.uHTS identification of compounds inhibiting the binding between the RUNX1 Runt domain and CBFb-SMMHC via a fluorescence resonance energy transfer (FRET) assay.
pH7.4±n/a
Temperature296.15±n/a K
IC50 14600±n/a nM
Citation PubChem, PC uHTS identification of compounds inhibiting the binding between the RUNX1 Runt domain and CBFbeta-SMMHC via a fluorescence resonance energy transfer (FRET) assay. PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Runt-Related Transcription Factor 1 Isoform AML1C
Name:Runt-Related Transcription Factor 1 Isoform AML1C
Synonyms:Acute myeloid leukemia 1 protein | CBF-alpha-2 | Core-binding factor subunit alpha-2 | Oncogene AML-1 | Polyomavirus enhancer-binding protein 2 alpha B subunit
Type:Subunit of heterodimeric transcription factor
Mol. Mass.:48750.25
Organism:Homo sapiens (Human)
Description:Q01196
Residue:453
Sequence:
MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPG
ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNA
TAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHR
QKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQM
QDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDL
TAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSATRYHTYLPPPYPG
SSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLP
NQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM29688
NameBDBM29688
Synonyms:3-(9-(3-chloro-4-{[(4-methylphenyl)sulfonyl]oxy}phenyl)-1,8-dioxo-2,3,4,5,6,7,8,9-octahydro-10(1H)-acridinyl)propanoic acid | 3-[9-(3-chloro-4-tosyloxy-phenyl)-1,8-diketo-3,4,5,6,7,9-hexahydro-2H-acridin-10-yl]propionic acid | 3-[9-[3-chloranyl-4-(4-methylphenyl)sulfonyloxy-phenyl]-1,8-bis(oxidanylidene)-3,4,5,6,7,9-hexahydro-2H-acridin-10-yl]propanoic acid | 3-[9-[3-chloro-4-(4-methylphenyl)sulfonyloxyphenyl]-1,8-dioxo-3,4,5,6,7,9-hexahydro-2H-acridin-10-yl]propanoic acid | MLS000704358 | SMR000230917 | cid_1770167
TypeSmall organic molecule
Emp. Form.C29H28ClNO7S
Mol. Mass.570.053
SMILESCc1ccc(cc1)S(=O)(=O)Oc1ccc(cc1Cl)C1C2=C(CCCC2=O)N(CCC(O)=O)C2=C1C(=O)CCC2 |c:35,t:21|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
Venus-CBFbeta-SMMHC
Name:Venus-CBFbeta-SMMHC
Synonyms:CBFbeta | Core-binding factor subunit beta isoform 2 | Venus-core-binding factor subunit beta-smooth muscle myosin heavy chain
Type:Fluorescent fusion protein
Mol. Mass.:21988.19
Organism:Homo sapiens (Human)
Description:Venus-CBFbeta-SMMHC was provided by Dr. John Bushweller (University of Virginia Charlottesville, Charlottesville VA). Only the amino acid sequence of core-binding factor subunit beta (CBFbeta) isoform 2 is shown here.
Residue:187
Sequence:
MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVAT
GTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLD
GMGCLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEARRQQDPSPGSNLGG
GDDLKLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: