BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCDK8/Cyclin C
LigandBDBM13533
Substrate/Competitorbiotinylated affinity ligand
Meas. Tech.Kinase Inhibitor Selectivity Profiling Assay
pH7.4±n/a
Temperature296.15±n/a K
Kd 220000±n/a nM
Citation PubChem, PC Kinase Inhibitor Selectivity Profiling Assay PubChem Bioassay(2008)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
CDK8/Cyclin C
Name:Cyclin-dependent kinase 8/19
Synonyms:Cell division protein kinase 8 | Cyclin-Dependent Kinase 8 (CDK8) | Mediator complex subunit CDK8 | Mediator of RNA polymerase II transcription subunit CDK8 | Protein kinase K35
Type:Serine/threonine-protein kinase
Mol. Mass.:53300.21
Organism:Homo sapiens
Description:gi_4502745
Residue:464
Sequence:
MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGIS
MSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKP
VQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLF
NSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQED
IKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKH
KVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLT
EEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTS
DYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM13533
biotinylated affinity ligand
Name:biotinylated affinity ligand
Synonyms:n/a
Type:n/a
Mol. Mass.:358.43
Organism:n/a
Description:n/a
Residue:3
Sequence:
n/a