BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBcl-2-related protein A1
LigandBDBM32329
Substrate/CompetitorFITC-conjugated-Bim BH3 Peptide
Meas. Tech.Multiplexed dose response screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bfl-1.
pH7.4±n/a
Temperature277.15±n/a K
EC50 41140±n/a nM
Citation PubChem, PC Multiplexed dose response screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bfl-1. PubChem Bioassay(2008)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Bcl-2-related protein A1
Name:Bcl-2-related protein A1
Synonyms:Bcl-2-like protein 5 | Hemopoietic-specific early response protein | Protein BFL-1 | Protein GRS
Type:Apoptosis regulator protein
Mol. Mass.:20130.01
Organism:Homo sapiens (human)
Description:n/a
Residue:175
Sequence:
MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVN
VVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISY
FVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32329
NameBDBM32329
Synonyms:(2Z)-3-ethyl-2-[(E)-3-(3-ethyl-1,3-benzothiazol-3-ium-2-yl)-2-methyl-prop-2-enylidene]-1,3-benzothiazole;iodide | (2Z)-3-ethyl-2-[(E)-3-(3-ethyl-1,3-benzothiazol-3-ium-2-yl)-2-methylprop-2-enylidene]-1,3-benzothiazole;iodide | Cyanines, 1 | MLS001018610 | SMR000354813 | cid_6364517
TypeSmall organic molecule
Emp. Form.C22H23N2S2
Mol. Mass.379.561
SMILESCCN1\C(Sc2ccccc12)=C\C(\C)=C\c1sc2ccccc2[n+]1CC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
FITC-conjugated-Bim BH3 Peptide
Name:FITC-conjugated-Bim BH3 Peptide
Synonyms:FITC-Ahx-DMRPEIWIAQELRRIGDEFNAYYAR-OH
Type:FITC-labeled Peptide
Mol. Mass.:3112.46
Organism:n/a
Description:n/a
Residue:25
Sequence:
DMRPEIWIAQELRRIGDEFNAYYAR