Reaction Details |
 | Report a problem with these data |
Target | HIV-1 Protease |
---|
Ligand | BDBM8125 |
---|
Substrate/Competitor | HIV Protease Substrate |
---|
Meas. Tech. | Enzyme Inhibition Assay (Ki) and Antiviral Activity Assay (EC50/IC50) |
---|
pH | 6.4±n/a |
---|
Temperature | 298.15±n/a K |
---|
Ki | 0.016±n/a nM |
---|
EC50 | 1.6±n/a nM |
---|
Citation | Ghosh, AK; Kulkarni, S; Anderson, DD; Hong, L; Baldridge, A; Wang, YF; Chumanevich, AA; Kovalevsky, AY; Tojo, Y; Amano, M; Koh, Y; Tang, J; Weber, IT; Mitsuya, H Design, synthesis, protein-ligand X-ray structure, and biological evaluation of a series of novel macrocyclic human immunodeficiency virus-1 protease inhibitors to combat drug resistance. J Med Chem52:7689-705 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
HIV-1 Protease |
---|
Name: | HIV-1 Protease |
Synonyms: | n/a |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | HIV-1 Protease chain A |
Synonyms: | n/a |
Type: | Enzyme Subunit |
Mol. Mass.: | 10732.11 |
Organism: | Human immunodeficiency virus type 1 |
Description: | The HIV-1 protease (Genbank HIVHXB2CG) clone was constructed with the substitutions Q7K, L33I, and L63I, to minimize the autoproteolysis of the protease, and C67A and C95A, to prevent cysteine-thiol oxidation. |
Residue: | 99 |
Sequence: | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
|
Component 2 |
Name: | HIV-1 Protease chain A |
Synonyms: | n/a |
Type: | Enzyme Subunit |
Mol. Mass.: | 10732.11 |
Organism: | Human immunodeficiency virus type 1 |
Description: | The HIV-1 protease (Genbank HIVHXB2CG) clone was constructed with the substitutions Q7K, L33I, and L63I, to minimize the autoproteolysis of the protease, and C67A and C95A, to prevent cysteine-thiol oxidation. |
Residue: | 99 |
Sequence: | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
|
BDBM8125 |
---|
Name | BDBM8125 |
Synonyms: | (3R,3aS,6aR)-hexahydrofuro[2,3-b]furan-3-yl N-[(2S,3R)-4-[(4-aminobenzene)(2-methylpropyl)sulfonamido]-3-hydroxy-1-phenylbutan-2-yl]carbamate | CHEMBL1323 | Darunavir | Darunavir (DRV) | TMC-114 | UIC-94017 | US10806794, Compound Darunavir |
Type | Small organic molecule |
Emp. Form. | C27H37N3O7S |
Mol. Mass. | 547.664 |
SMILES | [H][C@@]1(CO[C@@]2([H])OCC[C@@]12[H])OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(CC(C)C)S(=O)(=O)c1ccc(N)cc1 |r| |
Structure |  |
HIV Protease Substrate |
---|
Name: | HIV Protease Substrate |
Synonyms: | n/a |
Type: | Fluorogenic peptide |
Mol. Mass.: | 3467.28 |
Organism: | n/a |
Description: | n/a |
Residue: | 30 |
Sequence: | 2-(aminobenzoyl)-Thr-Ile-Nle-Phe(p-NO2)-Gln-ArgNH2
|
|
|