Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetActivin receptor type-1
LigandBDBM2579
Substrate/Competitorpoly(Glu4, Tyr)
Meas. Tech.in vitro Kinase Assay
IC50 4531.0±0.0 nM
Citation Hao, JHo, JNLewis, JAKarim, KADaniels, RNGentry, PRHopkins, CRLindsley, CWHong, CC In vivo structure-activity relationship study of dorsomorphin analogues identifies selective VEGF and BMP inhibitors. ACS Chem Biol5:245-53 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Activin receptor type-1
Name:Activin receptor type-1
Synonyms:2.7.11.30 | ACTR-I | ACVR1 | ACVRLK2 | ALK-2 | ALK2/ACVR1 | Activin receptor type I | Activin receptor-like kinase 2 | Activin receptor-like kinase 2 (ALK-2) | Activin receptor-like kinase 2 (ALK2/ACVR1) | Q04771 | SKR1 | Serine/threonine-protein kinase receptor R1 | TGF-B superfamily receptor type I | TSR-I
Type:n/a
Mol. Mass.:57158.32
Organism:Homo sapiens
Description:n/a
Residue:509
Sequence:
MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSIN
DGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF
HLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTL
ADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSR
DEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTL
DTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVM
HSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVS
NGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQ
NPSARLTALRIKKTLTKIDNSLDKLKTDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM2579
poly(Glu4, Tyr)
Name:poly(Glu4, Tyr)
Synonyms:n/a
Type:Random copolymer
Mol. Mass.:358.43
Organism:n/a
Description:n/a
Residue:3
Sequence:
n/a