Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein Wnt
LigandBDBM50294835
Substrate/Competitorn/a
Meas. Tech.Wnt Inhibition Assay
pH7.4±0
Temperature277.15±0 K
IC50 58±0.0 nM
Citation Chen, BDodge, METang, WLu, JMa, ZFan, CWWei, SHao, WKilgore, JWilliams, NSRoth, MGAmatruda, JFChen, CLum, L Small molecule-mediated disruption of Wnt-dependent signaling in tissue regeneration and cancer. Nat Chem Biol5:100-7 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Protein Wnt
Name:Protein Wnt
Synonyms:Wnt2
Type:Protein
Mol. Mass.:40507.27
Organism:Mus musculus (Mouse)
Description:P21552
Residue:360
Sequence:
MNVPLGGIWLWLPLLLTWLTPEVSSSWWYMRATGGSSRVMCDNVPGLVSRQRQLCHRHPD
VMRAIGLGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGELKSCSCDPKKKGSAKDSKGTFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCECKFHWCCAVRCQDCLEALDVHTCKAPKSADWATPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50294835
NameBDBM50294835
Synonyms:4-((1S,2S,6R,7R)-3,5-Dioxo-4-aza-tricyclo[5.2.1.0*2,6*]dec-8-en-4-yl)-N-methyl-N-quinolin-8-yl-benzamide | CHEMBL551505 | CHEMBL562310 | N-(Quinolin-8-yl)-4-(endo-4-aza-3,5-dioxotricyclo[5.2.1.02,6]oct-8-en-4-yl)benzamide, 1
TypeSmall organic molecule
Emp. Form.C25H19N3O3
Mol. Mass.409.4367
SMILESOc1c2[C@H]3C[C@H](C=C3)c2c(O)n1-c1ccc(cc1)C(=O)Nc1cccc2cccnc12 |r,c:6|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a