Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVitamin D3 receptor
LigandBDBM36717
Substrate/Competitorn/a
Meas. Tech.VDR Ligand-Binding Assay
pH7.5±0
Temperature277.15±0 K
Ki 0.5±0.0 nM
Citation Boehm, MFFitzgerald, PZou, AElgort, MGBischoff, EDMere, LMais, DEBissonnette, RPHeyman, RANadzan, AMReichman, MAllegretto, EA Novel nonsecosteroidal vitamin D mimics exert VDR-modulating activities with less calcium mobilization than 1,25-dihydroxyvitamin D3. Chem Biol6:265-75 (1999) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Vitamin D3 receptor
Name:Vitamin D3 receptor
Synonyms:1,25-dihydroxyvitamin D3 receptor | Nuclear receptor subfamily 1 group I member 1 | VDR
Type:Protein
Mol. Mass.:48288.72
Organism:Homo sapiens (Human)
Description:P11473
Residue:427
Sequence:
MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSL
RPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSG
DSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQK
VIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDV
TKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLS
NTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE
VFGNEIS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36717
NameBDBM36717
Synonyms:1,25(OH)2D3
TypeSmall organic molecule
Emp. Form.C30H50O
Mol. Mass.426.7174
SMILESCC(CCCC(C)(C)O)C1CCC2CC(CCC12C)\C=C\C=C1\C[C@@H](C)C[C@H](C)C1=C |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a