BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetfMet-Leu-Phe receptor 1/2
LigandBDBM32017
Substrate/Competitorn/a
Meas. Tech.Dose Response Assay for Formylpeptide Receptor-Like-1 (FPRL1) Ligands and Dose Response Counter-Screen Assay for Formylpeptide Receptor (FPR) Ligands
Ki 15200±n/a nM
CommentsExtracted from aid = 520 and tid = 2
Citation PubChem, PC Dose Response Assay for Formylpeptide Receptor-Like-1 (FPRL1) Ligands and Dose Response Counter-Screen Assay for Formylpeptide Receptor (FPR) Ligands PubChem Bioassay(2007)[AID]
More Info.:Get all data from this article,  Assay Method
 
fMet-Leu-Phe receptor 1/2
Name:fMet-Leu-Phe receptor 1/2
Synonyms:ALXR, FPRL1, FPR2 | FMLP-related receptor I FMLP-R-I | Formyl Peptide Receptor-Like 1 | HM63 | LXA4 receptor | Lipoxin A4 receptor | Lipoxin A4 receptor (LXA4) | RFP | hFPRL
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:38968.35
Organism:Homo sapiens (human)
Description:n/a
Residue:351
Sequence:
METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT
TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA
LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF
ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32017
NameBDBM32017
Synonyms:(7S,9S)-7-[(2R,4S,5S,6S)-4-azanyl-6-methyl-5-oxidanyl-oxan-2-yl]oxy-9-ethanoyl-4-methoxy-6,9,11-tris(oxidanyl)-8,10-dihydro-7H-tetracene-5,12-dione;hydrochloride | (7S,9S)-9-acetyl-7-[(2R,4S,5S,6S)-4-amino-5-hydroxy-6-methyl-tetrahydropyran-2-yl]oxy-6,9,11-trihydroxy-4-methoxy-8,10-dihydro-7H-tetracene-5,12-quinone;hydrochloride | (7S,9S)-9-acetyl-7-[(2R,4S,5S,6S)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-4-methoxy-8,10-dihydro-7H-tetracene-5,12-dione;hydrochloride | (7S,9S)-9-acetyl-7-[[(2R,4S,5S,6S)-4-amino-5-hydroxy-6-methyl-2-oxanyl]oxy]-6,9,11-trihydroxy-4-methoxy-8,10-dihydro-7H-tetracene-5,12-dione;hydrochloride | DAUNORUBICIN HYDROCHLORIDE | Daunorubicin | MLS000069508 | SMR000058559 | cid_62770
TypeSmall organic molecule
Emp. Form.C27H29NO10
Mol. Mass.527.5199
SMILESCOc1cccc2C(=O)c3c(O)c4C[C@](O)(C[C@H](O[C@H]5C[C@H](N)[C@H](O)[C@H](C)O5)c4c(O)c3C(=O)c12)C(C)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a