BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetdiphosphomevalonate decarboxylase
LigandBDBM38340
Substrate/Competitorn/a
Meas. Tech.Screening for Inhibitors of the Mevalonate Pathway in Streptococcus Pneumoniae - DPM-DC Dose Response
IC50 117902.8±n/a nM
Citation PubChem, PC Screening for Inhibitors of the Mevalonate Pathway in Streptococcus Pneumoniae - DPM-DC Dose Response PubChem Bioassay(2007)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
diphosphomevalonate decarboxylase
Name:diphosphomevalonate decarboxylase
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:35571.44
Organism:Streptococcus pneumoniae D39
Description:A0A0H2ZN59
Residue:317
Sequence:
MDREPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYTETTLSPLPANVTADEF
YINGQLQNEVEHAKMSKIIDRYRPAGEGFVRIDTQNNMPTAAGLSSSSSGLSALVKACNA
YFKLGLDRSQLAQEAKFASGSSSRSFYGPLGAWDKDSGEIYPVETDLKLAMIMLVLEDKK
KPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLKENDFAKIGELTEKNALAMHATT
KTASPAFSYLTDASYEAMDFVRQLREKGEACYFTMDAGPNVKVFCQEKDLEHLSEIFGQR
YRLIVSKTKDLSQDDCC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM38340
NameBDBM38340
Synonyms:MLS000082296 | N-(3-cyano-1-isobutyl-5-keto-10-methyl-dipyrido[3,4-c:1',2'-f]pyrimidin-2-ylidene)-piperonylamide | N-[3-cyano-10-methyl-1-(2-methylpropyl)-5-oxidanylidene-dipyrido[3,4-c:1',2'-f]pyrimidin-2-ylidene]-1,3-benzodioxole-5-carboxamide | N-[3-cyano-10-methyl-1-(2-methylpropyl)-5-oxo-2-dipyrido[3,4-c:1',2'-f]pyrimidinylidene]-1,3-benzodioxole-5-carboxamide | N-[3-cyano-10-methyl-1-(2-methylpropyl)-5-oxodipyrido[3,4-c:1',2'-f]pyrimidin-2-ylidene]-1,3-benzodioxole-5-carboxamide | SMR000046977 | cid_665853
TypeSmall organic molecule
Emp. Form.C25H21N5O4
Mol. Mass.455.4653
SMILESCC(C)Cn1c2nc3c(C)cccn3c(=O)c2cc(C#N)\c1=N/C(=O)c1ccc2OCOc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a