BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGalanin receptor 2
LigandBDBM50004233
Substrate/Competitorn/a
Meas. Tech.Dose response counterscreen for agonists of galanin receptor 2 (GalR2): a cell-based high-throughput screening assay for activators of beta-lactamase activity
EC50>55700±n/a nM
Citation PubChem, PC Dose response counterscreen for agonists of galanin receptor 2 (GalR2): a cell-based high-throughput screening assay for activators of beta-lactamase activity PubChem Bioassay(2008)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Galanin receptor 2
Name:Galanin receptor 2
Synonyms:GALR2 | Galanin R2 | Galanin receptor 2 | Galanin receptor type 2 | Galanin receptor type 2 (GAL2-R) (GALR2).
Type:Enzyme Catalytic Domain
Mol. Mass.:41724.40
Organism:Homo sapiens (Human)
Description:Galanin R2 GALR2 HUMAN::O43603
Residue:387
Sequence:
MNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTT
NLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVS
LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWS
APRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVDPVAAGSGARRAKRKVTRMILI
VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR
KGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQ
PCILEPCPGPSWQGPKAGDSILTVDVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004233
NameBDBM50004233
Synonyms:5,11-dimethyl-2H-pyrido[4,3-b]carbazole | CHEMBL123 | ELLIPTECINE | Ellipticin | Ellipticine | TCMDC-125546 | cid_3213
TypeSmall organic molecule
Emp. Form.C17H14N2
Mol. Mass.246.3065
SMILESCc1c2[nH]c3ccccc3c2c(C)c2cnccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a