BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlkaline phosphatase, tissue-nonspecific isozyme
LigandBDBM43801
Substrate/Competitorn/a
Meas. Tech.SAR assay for compounds activating TNAP in the absence of phosphate acceptor performed in a luminescent assay
EC50 26600±n/a nM
Citation PubChem, PC SAR assay for compounds activating TNAP in the absence of phosphate acceptor performed in a luminescent assay PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Alkaline phosphatase, tissue-nonspecific isozyme
Name:Alkaline phosphatase, tissue-nonspecific isozyme
Synonyms:tissue-nonspecific alkaline phosphatase precursor
Type:PROTEIN
Mol. Mass.:57306.17
Organism:Homo sapiens (Human)
Description:ChEMBL_1448917
Residue:524
Sequence:
MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGD
GMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCG
VKANEGTVGVSAATERSRCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAH
SADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMGGGRKYMYPKNKTDVEYESDE
KARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDPHNVDYLLGLFEPGDMQYELN
RNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIG
QAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPG
YKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYV
PHVMAYAACIGANLGHCAPASSAGSLAAGPLLLALALYPLSVLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM43801
NameBDBM43801
Synonyms:2-nitro-N-[[(2-nitrobenzoyl)amino]carbamothioyl]benzamide | 2-nitro-N-[[(2-nitrobenzoyl)amino]thiocarbamoyl]benzamide | 2-nitro-N-[[(2-nitrophenyl)carbonylamino]carbamothioyl]benzamide | 2-nitro-N-[[[(2-nitrophenyl)-oxomethyl]hydrazo]-sulfanylidenemethyl]benzamide | MLS-0106160.0001 | cid_3138362
TypeSmall organic molecule
Emp. Form.C15H11N5O6S
Mol. Mass.389.343
SMILES[O-][N+](=O)c1ccccc1C(=O)NNC(=S)NC(=O)c1ccccc1[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a