BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity protein phosphatase (VHR)
LigandBDBM46225
Substrate/Competitorn/a
Meas. Tech.SAR VHR1 absorbance Assay for In Vitro dose response studies.
IC50 1240±n/a nM
Citation PubChem, PC SAR VHR1 absorbance Assay for In Vitro dose response studies. PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Dual specificity protein phosphatase (VHR)
Name:Dual specificity protein phosphatase 3
Synonyms:Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR
Type:Hydrolase
Mol. Mass.:20480.58
Organism:Homo sapiens (Human)
Description:n/a
Residue:185
Sequence:
MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM46225
NameBDBM46225
Synonyms:MLS-0266851.0001 | cid_2545467
TypeSmall organic molecule
Emp. Form.C23H18N2O7S2
Mol. Mass.498.528
SMILESCCOC(=O)c1sc2nc3c(SCC(O)=O)cc(cn3c(=O)c2c1C)C(=O)c1ccccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a