BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(1B) dopamine receptor
LigandBDBM48980
Substrate/Competitorn/a
Meas. Tech.Allosteric Modulators of D1 Receptors: Dose-dependent Counterscreen
EC50 0.0331±n/a nM
Citation PubChem, PC Allosteric Modulators of D1 Receptors: Dose-dependent Counterscreen PubChem Bioassay(2007)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
D(1B) dopamine receptor
Name:D(1B) dopamine receptor
Synonyms:D(5) dopamine receptor | D1beta dopamine receptor | DOPAMINE D5 | DRD5 | dopamine receptor D5
Type:Protein
Mol. Mass.:52943.41
Organism:Homo sapiens (Human)
Description:P21918
Residue:477
Sequence:
MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL
VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD
IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW
HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI
MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV
IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA
FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP
GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM48980
NameBDBM48980
Synonyms:(1-isopropylbenzimidazol-2-yl)-phenyl-methanol | MLS000107285 | SMR000111657 | cid_2851813 | phenyl-(1-propan-2-yl-2-benzimidazolyl)methanol | phenyl-(1-propan-2-ylbenzimidazol-2-yl)methanol
TypeSmall organic molecule
Emp. Form.C17H18N2O
Mol. Mass.266.3376
SMILESCC(C)n1c(nc2ccccc12)C(O)c1ccccc1
Structure
n/a