BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInduced myeloid leukemia cell differentiation protein Mcl-1
LigandBDBM31075
Substrate/Competitorn/a
Meas. Tech.Dose Response Confirmation for Mcl-1/Noxa Interaction Inhibitors
IC50 893.763557±n/a nM
Citation PubChem, PC Dose Response Confirmation for Mcl-1/Noxa Interaction Inhibitors PubChem Bioassay(2008)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Induced myeloid leukemia cell differentiation protein Mcl-1
Name:Induced myeloid leukemia cell differentiation protein Mcl-1
Synonyms:Bcl-2-like protein 3 | Bcl-2-like protein 3 (Mcl-1) | Bcl-2-related protein EAT/mcl1 | Bcl2-L-3 | Induced myeloid leukemia cell differentiation protein (Mcl-1) | Mcl-1 | Myeloid Cell factor-1 (Mcl-1) | Myeloid cell leukemia sequence 1 (BCL2-related) | mcl1/EAT
Type:Membrane; Single-pass membrane protein
Mol. Mass.:37332.87
Organism:Homo sapiens (Human)
Description:n/a
Residue:350
Sequence:
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31075
NameBDBM31075
Synonyms:1-[2,3-bis(2-furanyl)-6-quinoxalinyl]-3-[4-(4-morpholinyl)phenyl]urea | 1-[2,3-bis(2-furyl)quinoxalin-6-yl]-3-(4-morpholinophenyl)urea | 1-[2,3-bis(furan-2-yl)quinoxalin-6-yl]-3-(4-morpholin-4-ylphenyl)urea | MLS000050329 | N-(2,3-di-2-furyl-6-quinoxalinyl)-N'-[4-(4-morpholinyl)phenyl]urea | SMR000077571 | cid_2214554
TypeSmall organic molecule
Emp. Form.C27H23N5O4
Mol. Mass.481.5026
SMILESO=C(Nc1ccc(cc1)N1CCOCC1)Nc1ccc2nc(-c3ccco3)c(nc2c1)-c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a