BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBZLF2
LigandBDBM51195
Substrate/Competitorn/a
Meas. Tech.Dose Response Confirmation for Small Molecule Inhibitors of Epstein-Barr Virus
IC50 28230±n/a nM
Citation PubChem, PC Dose Response Confirmation for Small Molecule Inhibitors of Epstein-Barr Virus PubChem Bioassay(2008)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
BZLF2
Name:BZLF2
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:25424.12
Organism:Human herpesvirus 4 type 2
Description:gi_139424501
Residue:223
Sequence:
MVSFKQVRVPLFTAIALVIVLLLAYFLPPRVRGGGRVSAAAITWVPKPNVEVWPVDPPPP
VNFNKTAEQEYGDKEIKLPHWTPTLHTFQVPKNYTKANCTYCNTREYTFSYKERCFYFTK
KKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIESLWVGVYRVGEGNWTSLDGG
TFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKPCLCVSQRSNS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM51195
NameBDBM51195
Synonyms:2-phenyl-2-(1-pyrrolidinyl)-N-(1,3-thiazol-2-yl)acetamide | 2-phenyl-2-(1-pyrrolidinyl)-N-(2-thiazolyl)acetamide | 2-phenyl-2-pyrrolidin-1-yl-N-(1,3-thiazol-2-yl)acetamide | 2-phenyl-2-pyrrolidin-1-yl-N-(1,3-thiazol-2-yl)ethanamide | 2-phenyl-2-pyrrolidino-N-thiazol-2-yl-acetamide | MLS000763373 | SMR000336239 | cid_5168984
TypeSmall organic molecule
Emp. Form.C15H17N3OS
Mol. Mass.287.38
SMILESO=C(Nc1nccs1)C(N1CCCC1)c1ccccc1
Structure
n/a