BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA repair protein RAD51 homolog 1
LigandBDBM51368
Substrate/Competitorn/a
Meas. Tech.Homologous recombination_Rad 51_dose response_2
IC50 53000±n/a nM
Citation PubChem, PC Homologous recombination_Rad 51_dose response_2 PubChem Bioassay(2008)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
DNA repair protein RAD51 homolog 1
Name:DNA repair protein RAD51 homolog 1
Synonyms:RAD51
Type:Enzyme Catalytic Domain
Mol. Mass.:36960.74
Organism:Homo sapiens (Human)
Description:gi_49168602
Residue:339
Sequence:
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
SGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM51368
NameBDBM51368
Synonyms:2-[[2-[[4-amino-5-(3-pyridinyl)-1,2,4-triazol-3-yl]thio]-1-oxoethyl]amino]benzoic acid methyl ester | 2-[[2-[[4-amino-5-(3-pyridyl)-1,2,4-triazol-3-yl]thio]acetyl]amino]benzoic acid methyl ester | MLS001005868 | SMR000349068 | cid_2388246 | methyl 2-[2-[(4-azanyl-5-pyridin-3-yl-1,2,4-triazol-3-yl)sulfanyl]ethanoylamino]benzoate | methyl 2-[[2-[(4-amino-5-pyridin-3-yl-1,2,4-triazol-3-yl)sulfanyl]acetyl]amino]benzoate
TypeSmall organic molecule
Emp. Form.C17H16N6O3S
Mol. Mass.384.412
SMILESCOC(=O)c1ccccc1NC(=O)CSc1nnc(-c2cccnc2)n1N
Structure
n/a