BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 2
LigandBDBM39739
Substrate/Competitorn/a
Meas. Tech.Dose Response Confirmation Screen via Multiplex HTS Assay for Inhibitors of MEK Kinase PB1 Domains, specifically MEK5 binding to MEK Kinase 2 Mutant
EC50 2070±n/a nM
Citation PubChem, PC Dose Response Confirmation Screen via Multiplex HTS Assay for Inhibitors of MEK Kinase PB1 Domains, specifically MEK5 binding to MEK Kinase 2 Mutant PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Mitogen-activated protein kinase 2
Name:Mitogen-activated protein kinase 2
Synonyms:2.7.11.1 | B lymphocyte serine/threonine-protein kinase | GC kinase | GCK | Germinal center kinase | MAP4K2 | MAPK/ERK kinase kinase kinase 2 | MEK kinase kinase 2 | MEKKK 2 | Mitogen-activated protein kinase kinase kinase kinase 2 | RAB8IP | Rab8-interacting protein
Type:n/a
Mol. Mass.:91551.35
Organism:Homo sapiens
Description:n/a
Residue:820
Sequence:
MALLRDVSLQDPRDRFELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDDISSLQQ
EITILRECRHPNVVAYIGSYLRNDRLWICMEFCGGGSLQEIYHATGPLEERQIAYVCREA
LKGLHHLHSQGKIHRDIKGANLLLTLQGDVKLADFGVSGELTASVAKRRSFIGTPYWMAP
EVAAVERKGGYNELCDVWALGITAIELGELQPPLFHLHPMRALMLMSKSSFQPPKLRDKT
RWTQNFHHFLKLALTKNPKKRPTAEKLLQHPFTTQQLPRALLTQLLDKASDPHLGTPSPE
DCELETYDMFPDTIHSRGQHGPAERTPSEIQFHQVKFGAPRRKETDPLNEPWEEEWTLLG
KEELSGSLLQSVQEALEERSLTIRSASEFQELDSPDDTMGTIKRAPFLGPLPTDPPAEEP
LSSPPGTLPPPPSGPNSSPLLPTAWATMKQREDPERSSCHGLPPTPKVHMGACFSKVFNG
CPLRIHAAVTWIHPVTRDQFLVVGAEEGIYTLNLHELHEDTLEKLISHRCSWLYCVNNVL
LSLSGKSTHIWAHDLPGLFEQRRLQQQVPLSIPTNRLTQRIIPRRFALSTKIPDTKGCLQ
CRVVRNPYTGATFLLAALPTSLLLLQWYEPLQKFLLLKNFSSPLPSPAGMLEPLVLDGKE
LPQVCVGAEGPEGPGCRVLFHVLPLEAGLTPDILIPPEGIPGSAQQVIQVDRDTILVSFE
RCVRIVNMQGEPTATLAPELTFDFPIETVVCLQDSVLAFWSHGMQGRSLDTNEVTQEITD
ETRIFRVLGAHRDIILESIPTDNPEAHSNLYILTGHQSTY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM39739
NameBDBM39739
Synonyms:3-[2-[[(3Z)-3-benzylidene-2-morpholin-4-ylcyclopenten-1-yl]methylidene]hydrazinyl]-5-bromoindol-2-one | 3-[N'-[[(3Z)-3-benzal-2-morpholino-cyclopenten-1-yl]methylene]hydrazino]-5-bromo-indol-2-one | 5-bromanyl-3-[2-[[(3Z)-2-morpholin-4-yl-3-(phenylmethylidene)cyclopenten-1-yl]methylidene]hydrazinyl]indol-2-one | 5-bromo-3-[2-[[(3Z)-2-(4-morpholinyl)-3-(phenylmethylene)-1-cyclopentenyl]methylidene]hydrazinyl]-2-indolone | MLS000568929 | SMR000150002 | cid_11834463
TypeSmall organic molecule
Emp. Form.C25H23BrN4O2
Mol. Mass.491.38
SMILESBrc1ccc2=NC(=O)C(NN=CC3=C(N4CCOCC4)C(CC3)=Cc3ccccc3)=c2c1 |w:10.9,23.25,c:12,32,t:4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a
NameBDBM39739
Synonyms:3-[2-[[(3Z)-3-benzylidene-2-morpholin-4-ylcyclopenten-1-yl]methylidene]hydrazinyl]-5-bromoindol-2-one | 3-[N'-[[(3Z)-3-benzal-2-morpholino-cyclopenten-1-yl]methylene]hydrazino]-5-bromo-indol-2-one | 5-bromanyl-3-[2-[[(3Z)-2-morpholin-4-yl-3-(phenylmethylidene)cyclopenten-1-yl]methylidene]hydrazinyl]indol-2-one | 5-bromo-3-[2-[[(3Z)-2-(4-morpholinyl)-3-(phenylmethylene)-1-cyclopentenyl]methylidene]hydrazinyl]-2-indolone | MLS000568929 | SMR000150002 | cid_11834463
TypeSmall organic molecule
Emp. Form.C25H23BrN4O2
Mol. Mass.491.38
SMILESBrc1ccc2=NC(=O)C(NN=CC3=C(N4CCOCC4)C(CC3)=Cc3ccccc3)=c2c1 |w:10.9,23.25,c:12,32,t:4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: