BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 2
LigandBDBM32065
Substrate/Competitorn/a
Meas. Tech.Dose Response Confirmation via Multiplex HTS Assay for Inhibitors of MEK Kinase PB1 Domains, specifically MEK5 binding to MEK Kinase 2 Wildtype
EC50 670±n/a nM
Citation PubChem, PC Dose Response Confirmation via Multiplex HTS Assay for Inhibitors of MEK Kinase PB1 Domains, specifically MEK5 binding to MEK Kinase 2 Wildtype PubChem Bioassay(2009)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Mitogen-activated protein kinase 2
Name:Mitogen-activated protein kinase 2
Synonyms:2.7.11.1 | B lymphocyte serine/threonine-protein kinase | GC kinase | GCK | Germinal center kinase | MAP4K2 | MAPK/ERK kinase kinase kinase 2 | MEK kinase kinase 2 | MEKKK 2 | Mitogen-activated protein kinase kinase kinase kinase 2 | RAB8IP | Rab8-interacting protein
Type:n/a
Mol. Mass.:91551.35
Organism:Homo sapiens
Description:n/a
Residue:820
Sequence:
MALLRDVSLQDPRDRFELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDDISSLQQ
EITILRECRHPNVVAYIGSYLRNDRLWICMEFCGGGSLQEIYHATGPLEERQIAYVCREA
LKGLHHLHSQGKIHRDIKGANLLLTLQGDVKLADFGVSGELTASVAKRRSFIGTPYWMAP
EVAAVERKGGYNELCDVWALGITAIELGELQPPLFHLHPMRALMLMSKSSFQPPKLRDKT
RWTQNFHHFLKLALTKNPKKRPTAEKLLQHPFTTQQLPRALLTQLLDKASDPHLGTPSPE
DCELETYDMFPDTIHSRGQHGPAERTPSEIQFHQVKFGAPRRKETDPLNEPWEEEWTLLG
KEELSGSLLQSVQEALEERSLTIRSASEFQELDSPDDTMGTIKRAPFLGPLPTDPPAEEP
LSSPPGTLPPPPSGPNSSPLLPTAWATMKQREDPERSSCHGLPPTPKVHMGACFSKVFNG
CPLRIHAAVTWIHPVTRDQFLVVGAEEGIYTLNLHELHEDTLEKLISHRCSWLYCVNNVL
LSLSGKSTHIWAHDLPGLFEQRRLQQQVPLSIPTNRLTQRIIPRRFALSTKIPDTKGCLQ
CRVVRNPYTGATFLLAALPTSLLLLQWYEPLQKFLLLKNFSSPLPSPAGMLEPLVLDGKE
LPQVCVGAEGPEGPGCRVLFHVLPLEAGLTPDILIPPEGIPGSAQQVIQVDRDTILVSFE
RCVRIVNMQGEPTATLAPELTFDFPIETVVCLQDSVLAFWSHGMQGRSLDTNEVTQEITD
ETRIFRVLGAHRDIILESIPTDNPEAHSNLYILTGHQSTY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32065
NameBDBM32065
Synonyms:2-[3-(2-furanylmethyl)-5-[[4-(N-methylanilino)phenyl]methylidene]-4-oxo-2-thiazolidinylidene]-4,4-dimethyl-3-oxopentanenitrile | 2-[3-(2-furfuryl)-4-keto-5-[4-(N-methylanilino)benzylidene]thiazolidin-2-ylidene]-3-keto-4,4-dimethyl-valeronitrile | 2-[3-(furan-2-ylmethyl)-5-[[4-(N-methylanilino)phenyl]methylidene]-4-oxo-1,3-thiazolidin-2-ylidene]-4,4-dimethyl-3-oxopentanenitrile | 2-[3-(furan-2-ylmethyl)-5-[[4-[methyl(phenyl)amino]phenyl]methylidene]-4-oxidanylidene-1,3-thiazolidin-2-ylidene]-4,4-dimethyl-3-oxidanylidene-pentanenitrile | MLS000054217 | SMR000062131 | cid_2998484
TypeSmall organic molecule
Emp. Form.C29H27N3O3S
Mol. Mass.497.608
SMILESCN(c1ccccc1)c1ccc(C=c2s\c(=C(\C#N)C(=O)C(C)(C)C)n(Cc3ccco3)c2=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a