BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPOsterior Segregation family member (pos-1)
LigandBDBM52067
Substrate/Competitorn/a
Meas. Tech.Fluorescent Polarization Homogeneous Dose Response HTS to Indentify Inhibitors of POS-1 Binding to mex-3-RNA
EC50 300000±n/a nM
Citation PubChem, PC Fluorescent Polarization Homogeneous Dose Response HTS to Indentify Inhibitors of POS-1 Binding to mex-3-RNA PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
POsterior Segregation family member (pos-1)
Name:POsterior Segregation family member (pos-1)
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:29838.90
Organism:Caenorhabditis elegans
Description:gi_17562800
Residue:264
Sequence:
MADNDFLSGEAIMVFKKEILDSHSDFTRSLSHQSASPEAYDQENVFSQDFQPFMKQDKET
QNSASQPTSEQSLANRDPCTVPDDLREEMMRQRRKEDAFKTALCDAYKRSQACSYGDQCR
FAHGVHELRLPMNPRGRNHPKYKTVLCDKFSMTGNCKYGTRCQFIHKIVDGNAAKLASGA
HANTSSKSPARNAAAHNHSLFVPQGSTDRSMDLNQSLPIRQSDLVRAFARATRLDVSGYN
STAQLAQYFESQFQRIQQLSSHHH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM52067
NameBDBM52067
Synonyms:2-Amino-5-oxo-4-(2,3,4-trimethoxy-phenyl)-5,6,7,8-tetrahydro-4H-chromene-3-carbonitrile | 2-amino-5-keto-4-(2,3,4-trimethoxyphenyl)-4,6,7,8-tetrahydrochromene-3-carbonitrile | 2-amino-5-oxo-4-(2,3,4-trimethoxyphenyl)-4,6,7,8-tetrahydro-1-benzopyran-3-carbonitrile | 2-amino-5-oxo-4-(2,3,4-trimethoxyphenyl)-4,6,7,8-tetrahydrochromene-3-carbonitrile | 2-azanyl-5-oxidanylidene-4-(2,3,4-trimethoxyphenyl)-4,6,7,8-tetrahydrochromene-3-carbonitrile | MLS000031250 | SMR000011307 | cid_649019
TypeSmall organic molecule
Emp. Form.C19H20N2O5
Mol. Mass.356.3725
SMILESCOc1ccc(C2C(C#N)C(=N)OC3=C2C(=O)CCC3)c(OC)c1OC |c:13|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a