BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPOsterior Segregation family member (pos-1)
LigandBDBM52209
Substrate/Competitorn/a
Meas. Tech.Fluorescent Polarization Homogeneous Dose Response HTS to Indentify Inhibitors of POS-1 Binding to mex-3-RNA
EC50 300000±n/a nM
Citation PubChem, PC Fluorescent Polarization Homogeneous Dose Response HTS to Indentify Inhibitors of POS-1 Binding to mex-3-RNA PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
POsterior Segregation family member (pos-1)
Name:POsterior Segregation family member (pos-1)
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:29838.90
Organism:Caenorhabditis elegans
Description:gi_17562800
Residue:264
Sequence:
MADNDFLSGEAIMVFKKEILDSHSDFTRSLSHQSASPEAYDQENVFSQDFQPFMKQDKET
QNSASQPTSEQSLANRDPCTVPDDLREEMMRQRRKEDAFKTALCDAYKRSQACSYGDQCR
FAHGVHELRLPMNPRGRNHPKYKTVLCDKFSMTGNCKYGTRCQFIHKIVDGNAAKLASGA
HANTSSKSPARNAAAHNHSLFVPQGSTDRSMDLNQSLPIRQSDLVRAFARATRLDVSGYN
STAQLAQYFESQFQRIQQLSSHHH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM52209
NameBDBM52209
Synonyms:2-amino-5-keto-4-phenyl-4,6,7,8-tetrahydrochromene-3-carbonitrile | 2-amino-5-oxo-4-phenyl-4,6,7,8-tetrahydro-1-benzopyran-3-carbonitrile | 2-amino-5-oxo-4-phenyl-4,6,7,8-tetrahydrochromene-3-carbonitrile | 2-azanyl-5-oxidanylidene-4-phenyl-4,6,7,8-tetrahydrochromene-3-carbonitrile | MLS000105493 | SMR000102374 | cid_605218
TypeSmall organic molecule
Emp. Form.C16H14N2O2
Mol. Mass.266.2946
SMILESN=C1OC2=C(C(C1C#N)c1ccccc1)C(=O)CCC2 |c:3|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a