Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNuclear receptor ROR-gamma
LigandBDBM268403
Substrate/Competitorn/a
Meas. Tech.Nuclear receptor ROR-gamma
Temperature298.15±n/a K
EC50 262±n/a nM
Commentsextracted
Citation Fauber, BGobbi, A Keto-imidazopyridine derivatives as RORc modulators US Patent US9550771 Publication Date 1/24/2017
More Info.:Get all data from this article,  Assay Method
 
Nuclear receptor ROR-gamma
Name:Nuclear receptor ROR-gamma
Synonyms:Nuclear receptor ROR-gamma (aa 262-507) | ROR-gamma (A262-S507)
Type:Enzyme Catalytic Domain
Mol. Mass.:28605.37
Organism:Homo sapiens (Human)
Description:aa 262-507
Residue:246
Sequence:
APYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCA
HHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGK
YGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQ
LQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPL
YKELFS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM268403
NameBDBM268403
Synonyms:4-(6-(2,6-Dichlorobenzoyl)imidazo[1,5-a]pyrimidin-8-yl)benzoic acid | US9550771, Example 2
TypeSmall organic molecule
Emp. Form.C20H12Cl2N2O2S
Mol. Mass.415.292
SMILESOC(=O)c1ccc(cc1)-c1nc(Sc2c(Cl)cccc2Cl)n2ccccc12
Structure
n/a