BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetstreptokinase A precursor
LigandBDBM57524
Substrate/Competitorn/a
Meas. Tech.Absorbance Microorganism-Based Dose Response HTS to Identify Inhibitors of Streptokinase Expression
EC50 150000±n/a nM
Citation PubChem, PC Absorbance Microorganism-Based Dose Response HTS to Identify Inhibitors of Streptokinase Expression PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
streptokinase A precursor
Name:streptokinase A precursor
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:49924.80
Organism:Streptococcus pyogenes M1 GAS
Description:gi_15675770
Residue:440
Sequence:
MKNYLSIGVIALLFALTFGTVKSVQAIAGYGWLPDRPPINNSQLVVSMAGIVEGTDKKVF
INFFEIDLTSQPAHGGKTEQGLSPKSKPFATDNGAMPHKLEKADLLKAIQKQLIANVHSN
DGYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQPVQEFLLKGHVRVRPYKEKPVQNQ
AKSVDVEYTVQFTPLNPDDDFRPGLKDTKLLKTLAIGDTITSQELLAQAQSILNKTHPGY
TIYERDSSIVTHDNDIFRTILPMDQEFTYHVKNREQAYEINPKTGIKEKTNNTDLVSEKY
YVLKQGEKPYDPFDRSHLKLFTIKYVDVNTNELLKSEQLLTASERNLDFRDLYDPRDKAK
LLYNNLDAFDIMDYTLTGKVEDNHDKNNRVVTVYMGKRPKGAKGSYHLAYDKDLYTEEER
KAYSYLRDTGTPIPDNPKDK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM57524
NameBDBM57524
Synonyms:MLS000568816 | N-[(2-thiophen-2-ylethanoylamino)carbamothioyl]benzamide | N-[N'-(2-Thiophen-2-yl-acetyl)-hydrazinocarbothioyl]-benzamide | N-[[(1-oxo-2-thiophen-2-ylethyl)hydrazo]-sulfanylidenemethyl]benzamide | N-[[(2-thiophen-2-ylacetyl)amino]carbamothioyl]benzamide | N-[[[2-(2-thienyl)acetyl]amino]thiocarbamoyl]benzamide | SMR000177005 | cid_3132680
TypeSmall organic molecule
Emp. Form.C14H13N3O2S2
Mol. Mass.319.402
SMILESO=C(Cc1cccs1)NNC(=S)NC(=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a