BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetlarge T antigen
LigandBDBM48554
Substrate/Competitorn/a
Meas. Tech.Identification of SV40 T antigen inhibitors: Cytotoxicity screen of selected hits
EC50 17300±n/a nM
Citation PubChem, PC Identification of SV40 T antigen inhibitors: Cytotoxicity screen of selected hits PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
large T antigen
Name:large T antigen
Synonyms:LT | LT-AG
Type:Enzyme Catalytic Domain
Mol. Mass.:81575.54
Organism:Simian virus 40
Description:P03070
Residue:708
Sequence:
MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYK
KMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNEENLFCSEEMPSSDDEATADS
QHSTPPKKKRKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYS
VTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDP
FSVIEESLPGGLKEHDFNPEEAEETKQVSWKLVTEYAMETKCDDVLLLLGMYLEFQYSFE
MCLKCIKKEQPSHYKYHEKHYANAAIFADSKNQKTICQQAVDTVLAKKRVDSLQLTREQM
LTNRFNDLLDRMDIMFGSTGSADIEEWMAGVAWLHCLLPKMDSVVYDFLKCMVYNIPKKR
YWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGG
ESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEFSVPKTLQAR
FVKQIDFRAKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWK
ERLDKEFSLSVYQKMKFNVAMGIGVLDWLRNSDDDDEDSQENADKNEDGGEKNMEDSGHE
TGIDSQSQGSFQAPQSSQSVHDHNQPYHICRGFTCFKKPPTPPPEPET
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM48554
NameBDBM48554
Synonyms:(4Z)-3-hydroxy-4-(4-quinolin-8-yl-1,2-dihydropyrazol-3-ylidene)cyclohexa-2,5-dien-1-one | (4Z)-3-hydroxy-4-[4-(8-quinolinyl)-1,2-dihydropyrazol-3-ylidene]-1-cyclohexa-2,5-dienone | (4Z)-3-hydroxy-4-[4-(8-quinolyl)-3-pyrazolin-3-ylidene]cyclohexa-2,5-dien-1-one | (4Z)-3-oxidanyl-4-(4-quinolin-8-yl-1,2-dihydropyrazol-3-ylidene)cyclohexa-2,5-dien-1-one | MLS000054375 | SMR000065872 | cid_5668702
TypeSmall organic molecule
Emp. Form.C18H13N3O2
Mol. Mass.303.3147
SMILESOc1ccc(-c2n[nH]cc2-c2cccc3cccnc23)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a