BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetlarge T antigen
LigandBDBM58992
Substrate/Competitorn/a
Meas. Tech.Identification of SV40 T antigen inhibitors: Cytotoxicity screen of selected hits
EC50 27540±n/a nM
Citation PubChem, PC Identification of SV40 T antigen inhibitors: Cytotoxicity screen of selected hits PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
large T antigen
Name:large T antigen
Synonyms:LT | LT-AG
Type:Enzyme Catalytic Domain
Mol. Mass.:81575.54
Organism:Simian virus 40
Description:P03070
Residue:708
Sequence:
MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYK
KMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNEENLFCSEEMPSSDDEATADS
QHSTPPKKKRKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYS
VTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDP
FSVIEESLPGGLKEHDFNPEEAEETKQVSWKLVTEYAMETKCDDVLLLLGMYLEFQYSFE
MCLKCIKKEQPSHYKYHEKHYANAAIFADSKNQKTICQQAVDTVLAKKRVDSLQLTREQM
LTNRFNDLLDRMDIMFGSTGSADIEEWMAGVAWLHCLLPKMDSVVYDFLKCMVYNIPKKR
YWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGG
ESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEFSVPKTLQAR
FVKQIDFRAKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWK
ERLDKEFSLSVYQKMKFNVAMGIGVLDWLRNSDDDDEDSQENADKNEDGGEKNMEDSGHE
TGIDSQSQGSFQAPQSSQSVHDHNQPYHICRGFTCFKKPPTPPPEPET
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM58992
NameBDBM58992
Synonyms:4-N,4-N-dimethyl-1-N-[4-(2-methylimidazo[1,2-a]pyrimidin-3-yl)-1,3-thiazol-2-yl]benzene-1,4-diamine;hydrobromide | MLS000681349 | N,N-dimethyl-N'-[4-(2-methylimidazo[1,2-a]pyrimidin-3-yl)-1,3-thiazol-2-yl]-1,4-benzenediamine hydrobromide | N4,N4-dimethyl-N1-[4-(2-methyl-3-imidazo[1,2-a]pyrimidinyl)-2-thiazolyl]benzene-1,4-diamine;hydrobromide | N4,N4-dimethyl-N1-[4-(2-methylimidazo[1,2-a]pyrimidin-3-yl)-1,3-thiazol-2-yl]benzene-1,4-diamine;hydrobromide | SMR000267732 | cid_2877526 | dimethyl-[4-[[4-(2-methylimidazo[1,2-a]pyrimidin-3-yl)thiazol-2-yl]amino]phenyl]amine;hydrobromide
TypeSmall organic molecule
Emp. Form.C18H18N6S
Mol. Mass.350.441
SMILESCN(C)c1ccc(Nc2nc(cs2)-c2c(C)nc3ncccn23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a