BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetlarge T antigen
LigandBDBM34849
Substrate/Competitorn/a
Meas. Tech.Identification of SV40 T antigen inhibitors: Cytotoxicity screen of selected hits
EC50 14550±n/a nM
Citation PubChem, PC Identification of SV40 T antigen inhibitors: Cytotoxicity screen of selected hits PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
large T antigen
Name:large T antigen
Synonyms:LT | LT-AG
Type:Enzyme Catalytic Domain
Mol. Mass.:81575.54
Organism:Simian virus 40
Description:P03070
Residue:708
Sequence:
MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYK
KMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNEENLFCSEEMPSSDDEATADS
QHSTPPKKKRKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYS
VTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDP
FSVIEESLPGGLKEHDFNPEEAEETKQVSWKLVTEYAMETKCDDVLLLLGMYLEFQYSFE
MCLKCIKKEQPSHYKYHEKHYANAAIFADSKNQKTICQQAVDTVLAKKRVDSLQLTREQM
LTNRFNDLLDRMDIMFGSTGSADIEEWMAGVAWLHCLLPKMDSVVYDFLKCMVYNIPKKR
YWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGG
ESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEFSVPKTLQAR
FVKQIDFRAKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWK
ERLDKEFSLSVYQKMKFNVAMGIGVLDWLRNSDDDDEDSQENADKNEDGGEKNMEDSGHE
TGIDSQSQGSFQAPQSSQSVHDHNQPYHICRGFTCFKKPPTPPPEPET
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM34849
NameBDBM34849
Synonyms:6-fluoranyl-2-(2-methylphenyl)-1,2-benzothiazol-3-one | 6-fluoro-2-(2-methylphenyl)-1,2-benzisothiazol-3(2H)-one | 6-fluoro-2-(2-methylphenyl)-1,2-benzothiazol-3-one | 6-fluoro-2-(o-tolyl)-1,2-benzothiazol-3-one | MLS000729299 | SMR000307577 | cid_1510379
TypeSmall organic molecule
Emp. Form.C14H10FNOS
Mol. Mass.259.299
SMILESCc1ccccc1-n1sc2cc(F)ccc2c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a