BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlkaline phosphatase placental-like
LigandBDBM39595
Substrate/Competitorn/a
Meas. Tech.Luminescent assay for HTS discovery of chemical activators of placental alkaline phosphatase
EC50 8520±n/a nM
Citation PubChem, PC Luminescent assay for HTS discovery of chemical activators of placental alkaline phosphatase PubChem Bioassay(2007)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Alkaline phosphatase placental-like
Name:Alkaline phosphatase placental-like
Synonyms:placental-like alkaline phosphatase preproprotein
Type:PROTEIN
Mol. Mass.:57374.31
Organism:Homo sapiens (Human)
Description:ChEMBL_29964
Residue:532
Sequence:
MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLG
DGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLC
GVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYA
HTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDY
SQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPSVTHLMGLFEPGDMKYEIHRD
STLDPSLMEMTEAALLLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERA
GQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVL
KDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV
MAFAACLEPYTACDLAPRAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM39595
NameBDBM39595
Synonyms:MLS000082269 | N,N-dimethyl-4-(1-propan-2-yl-2-benzimidazolyl)aniline | N,N-dimethyl-4-(1-propan-2-ylbenzimidazol-2-yl)aniline | SMR000046198 | [4-(1-isopropylbenzimidazol-2-yl)phenyl]-dimethyl-amine | cid_665078
TypeSmall organic molecule
Emp. Form.C18H21N3
Mol. Mass.279.3794
SMILESCC(C)n1c(nc2ccccc12)-c1ccc(cc1)N(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a