BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetleucine aminopeptidase
LigandBDBM57524
Substrate/Competitorn/a
Meas. Tech.Inhibitors of Plasmodium falciparum M17- Family Leucine Aminopeptidase (M17LAP)
IC50 30000±n/a nM
Citation PubChem, PC Inhibitors of Plasmodium falciparum M17- Family Leucine Aminopeptidase (M17LAP) PubChem Bioassay(2009)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
leucine aminopeptidase
Name:leucine aminopeptidase
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:67834.32
Organism:Plasmodium falciparum 3D7
Description:gi_124809582
Residue:605
Sequence:
MYFSSLCKFLPISEKEKIYLNIVKKRFCKSNIYYNNNNNNIINYNKRGLKFYPFCNNLKK
NINFVNINNKKGINFHSINKERKMASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGG
CNVEEGLTIFLVNNPGKENGPVKISSKVNDKNVSEFLKDENMEKFNVKLGTSKHFYMFND
NKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLE
TLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAA
PSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYK
SKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPEN
VEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDY
IVDIATLTGAMLYSLGTSYAGVFGNNEELINKILNSSKTSNEPVWWLPIINEYRATLNSK
YADINNISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFV
LNDAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM57524
NameBDBM57524
Synonyms:MLS000568816 | N-[(2-thiophen-2-ylethanoylamino)carbamothioyl]benzamide | N-[N'-(2-Thiophen-2-yl-acetyl)-hydrazinocarbothioyl]-benzamide | N-[[(1-oxo-2-thiophen-2-ylethyl)hydrazo]-sulfanylidenemethyl]benzamide | N-[[(2-thiophen-2-ylacetyl)amino]carbamothioyl]benzamide | N-[[[2-(2-thienyl)acetyl]amino]thiocarbamoyl]benzamide | SMR000177005 | cid_3132680
TypeSmall organic molecule
Emp. Form.C14H13N3O2S2
Mol. Mass.319.402
SMILESO=C(Cc1cccs1)NNC(=S)NC(=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a