BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHsf1 protein
LigandBDBM63491
Substrate/Competitorn/a
Meas. Tech.Luminescence Cell-Based Dose Confimation HTS to Identify Inhibitors of Heat Shock Factor 1 (HSF1)
EC50>195000±0 nM
Citation PubChem, PC Luminescence Cell-Based Dose Confimation HTS to Identify Inhibitors of Heat Shock Factor 1 (HSF1) PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Hsf1 protein
Name:Hsf1 protein
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:57208.68
Organism:Mus musculus
Description:P38532
Residue:525
Sequence:
MDLAVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKY
FKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT
SVSTLKSEDIKIRQDSVTRLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHA
QQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLSDSNSAHSVPKYGRQYSLEHVHGPGPY
SAPSPAYSSSSLYSSDAVTSSGPIISDITELAPTSPLASPGRSIDERPLSSSTLVRVKQE
PPSPPHSPRVLEASPGRPSSMDTPLSPTAFIDSILRESEPTPAASNTAPMDTTGAQAPAL
PTPSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLTSHGFSVDTSALLDLFSPSVTM
PDMSLPDLDSSLASIQELLSPQEPPRPIEAENSNPDSGKQLVHYTAQPLFLLDPDAVDTG
SSELPVLFELGESSYFSEGDDYTDDPTISLLTGTEPHKAKDPTVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM63491
NameBDBM63491
Synonyms:4-[[3-(2-hydroxyethyl)-4-(2-phenylethyl)-1-piperazinyl]methyl]benzoic acid methyl ester | 4-[[3-(2-hydroxyethyl)-4-phenethyl-piperazino]methyl]benzoic acid methyl ester | MLS000732872 | SMR000316123 | cid_16190140 | methyl 4-[[3-(2-hydroxyethyl)-4-(2-phenylethyl)piperazin-1-yl]methyl]benzoate | methyl 4-{[3-(2-hydroxyethyl)-4-(2-phenylethyl)piperazin-1-yl]methyl}benzoate
TypeSmall organic molecule
Emp. Form.C23H30N2O3
Mol. Mass.382.4959
SMILESCOC(=O)c1ccc(CN2CCN(CCc3ccccc3)C(CCO)C2)cc1
Structure
n/a