BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMEP2
LigandBDBM33111
Substrate/Competitorn/a
Meas. Tech.Dose Response of TOR pathway GFP-fusion proteins in Saccharomyes cerevisiae specifically MEP2 based on MLPCN hits
EC50 2277±n/a nM
Citation PubChem, PC Dose Response of TOR pathway GFP-fusion proteins in Saccharomyes cerevisiae specifically MEP2 based on MLPCN hits PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
MEP2
Name:MEP2
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:53401.07
Organism:Saccharomyces cerevisiae
Description:gi_1302091
Residue:499
Sequence:
MSYNFTGTPTGEGTGGNSLTTDLNTQFDLANMGWIGVASAGVWIMVPGIGLLYSGLSRKK
HALSLLWASMMASAVCIFQWFFWGYSLAFSHNTRGNGFIGTLEFFGFRNVLGAPSSVSSL
PDILFAVYQGMFAAVTGALMLGGACERARLFPMMVFLFLWMTIVYCPIACWVWNAEGWLV
KLGSLDYAGGLCVHLTSGHGGLVYALILGKRNDPVTRKGMPKYKPHSVTSVVLGTVFLWF
GWMFFNGGSAGNATIRAWYSIMSTNLAAACGGLTWMVIDYFRCGRKWTTVGLCSGIIAGL
VGITPAAGFVPIWSAVVIGVVTGAGCNLAVDLKSLLRIDDGLDCYSIHGVGGCIGSVLTG
IFAADYVNATAGSYISPIDGGWINHHYKQVGYQLAGICAALAWTVTVTSILLLTMNAIPF
LKLRLSADEEELGTDAAQIGEFTYEESTAYIPEPIRSKTSAQMPPPHENIDDKIVGNTDA
EKNSTPSDASSTKNTDHIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM33111
NameBDBM33111
Synonyms:4,4,4-Trichloro-3-methylamino-1-(4-nitro-phenyl)-butan-1-one | 4,4,4-trichloro-3-(methylamino)-1-(4-nitrophenyl)-1-butanone | 4,4,4-trichloro-3-(methylamino)-1-(4-nitrophenyl)butan-1-one | 4,4,4-tris(chloranyl)-3-(methylamino)-1-(4-nitrophenyl)butan-1-one | MLS000590271 | SMR000217256 | cid_3739292
TypeSmall organic molecule
Emp. Form.C11H11Cl3N2O3
Mol. Mass.325.576
SMILESCNC(CC(=O)c1ccc(cc1)[N+]([O-])=O)C(Cl)(Cl)Cl
Structure
n/a