BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMEP2
LigandBDBM33150
Substrate/Competitorn/a
Meas. Tech.Dose Response of TOR pathway GFP-fusion proteins in Saccharomyes cerevisiae specifically MEP2 based on MLPCN hits
EC50 13690±n/a nM
Citation PubChem, PC Dose Response of TOR pathway GFP-fusion proteins in Saccharomyes cerevisiae specifically MEP2 based on MLPCN hits PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
MEP2
Name:MEP2
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:53401.07
Organism:Saccharomyces cerevisiae
Description:gi_1302091
Residue:499
Sequence:
MSYNFTGTPTGEGTGGNSLTTDLNTQFDLANMGWIGVASAGVWIMVPGIGLLYSGLSRKK
HALSLLWASMMASAVCIFQWFFWGYSLAFSHNTRGNGFIGTLEFFGFRNVLGAPSSVSSL
PDILFAVYQGMFAAVTGALMLGGACERARLFPMMVFLFLWMTIVYCPIACWVWNAEGWLV
KLGSLDYAGGLCVHLTSGHGGLVYALILGKRNDPVTRKGMPKYKPHSVTSVVLGTVFLWF
GWMFFNGGSAGNATIRAWYSIMSTNLAAACGGLTWMVIDYFRCGRKWTTVGLCSGIIAGL
VGITPAAGFVPIWSAVVIGVVTGAGCNLAVDLKSLLRIDDGLDCYSIHGVGGCIGSVLTG
IFAADYVNATAGSYISPIDGGWINHHYKQVGYQLAGICAALAWTVTVTSILLLTMNAIPF
LKLRLSADEEELGTDAAQIGEFTYEESTAYIPEPIRSKTSAQMPPPHENIDDKIVGNTDA
EKNSTPSDASSTKNTDHIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM33150
NameBDBM33150
Synonyms:3-[(E)-3-(2,4-dimethylphenyl)-1-oxoprop-2-enyl]-2-hydroxy-1-cyclohepta-2,4,6-trienone | 3-[(E)-3-(2,4-dimethylphenyl)acryloyl]-2-hydroxy-cyclohepta-2,4,6-trien-1-one | 3-[(E)-3-(2,4-dimethylphenyl)prop-2-enoyl]-2-hydroxycyclohepta-2,4,6-trien-1-one | 3-[(E)-3-(2,4-dimethylphenyl)prop-2-enoyl]-2-oxidanyl-cyclohepta-2,4,6-trien-1-one | 3-[3-(2,4-dimethylphenyl)acryloyl]-2-hydroxy-2,4,6-cycloheptatrien-1-one | MLS000702110 | SMR000229842 | cid_7314606
TypeSmall organic molecule
Emp. Form.C18H16O3
Mol. Mass.280.3178
SMILESCc1ccc(\C=C\C(=O)c2ccccc(=O)c2O)c(C)c1
Structure
n/a