BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMEP2
LigandBDBM66010
Substrate/Competitorn/a
Meas. Tech.Dose Response of TOR pathway GFP-fusion proteins in Saccharomyes cerevisiae specifically MEP2 based on MLPCN hits
EC50 6846±n/a nM
Citation PubChem, PC Dose Response of TOR pathway GFP-fusion proteins in Saccharomyes cerevisiae specifically MEP2 based on MLPCN hits PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
MEP2
Name:MEP2
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:53401.07
Organism:Saccharomyces cerevisiae
Description:gi_1302091
Residue:499
Sequence:
MSYNFTGTPTGEGTGGNSLTTDLNTQFDLANMGWIGVASAGVWIMVPGIGLLYSGLSRKK
HALSLLWASMMASAVCIFQWFFWGYSLAFSHNTRGNGFIGTLEFFGFRNVLGAPSSVSSL
PDILFAVYQGMFAAVTGALMLGGACERARLFPMMVFLFLWMTIVYCPIACWVWNAEGWLV
KLGSLDYAGGLCVHLTSGHGGLVYALILGKRNDPVTRKGMPKYKPHSVTSVVLGTVFLWF
GWMFFNGGSAGNATIRAWYSIMSTNLAAACGGLTWMVIDYFRCGRKWTTVGLCSGIIAGL
VGITPAAGFVPIWSAVVIGVVTGAGCNLAVDLKSLLRIDDGLDCYSIHGVGGCIGSVLTG
IFAADYVNATAGSYISPIDGGWINHHYKQVGYQLAGICAALAWTVTVTSILLLTMNAIPF
LKLRLSADEEELGTDAAQIGEFTYEESTAYIPEPIRSKTSAQMPPPHENIDDKIVGNTDA
EKNSTPSDASSTKNTDHIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM66010
NameBDBM66010
Synonyms:4-N-(3-fluorophenyl)-2-N-methyl-5-nitropyrimidine-2,4,6-triamine | MLS000332706 | N'-(3-Fluoro-phenyl)-N-methyl-5-nitro-pyrimidine-2,4,6-triamine | N4-(3-fluorophenyl)-N2-methyl-5-nitro-pyrimidine-2,4,6-triamine | N4-(3-fluorophenyl)-N2-methyl-5-nitropyrimidine-2,4,6-triamine | SMR000436035 | [4-amino-6-(3-fluoroanilino)-5-nitro-pyrimidin-2-yl]-methyl-amine | cid_3528206
TypeSmall organic molecule
Emp. Form.C11H11FN6O2
Mol. Mass.278.2424
SMILESCNc1nc(N)c(c(Nc2cccc(F)c2)n1)[N+]([O-])=O
Structure
n/a