BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLAP4
LigandBDBM66023
Substrate/Competitorn/a
Meas. Tech.Dose Response of TOR pathway GFP-fusion proteins in Saccharomyes cerevisiae specifically LAP4 based on MLPCN hits
EC50 912±n/a nM
Citation PubChem, PC Dose Response of TOR pathway GFP-fusion proteins in Saccharomyes cerevisiae specifically LAP4 based on MLPCN hits PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
LAP4
Name:LAP4
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:57084.90
Organism:Saccharomyces cerevisiae
Description:gi_486173
Residue:514
Sequence:
MEEQREILEQLKKTLQMLTVEPSKNNQIANEEKEKKENENSWCILEHNYEDIAQEFIDFI
YKNPTTYHVVSFFAELLDKHNFKYLSEKSNWQDSIGEDGGKFYTIRNGTNLSAFILGKNW
RAEKGVGVIGSHVDALTVKLKPVSFKDTAEGYGRIAVAPYGGTLNELWLDRDLGIGGRLL
YKKKGTNEIKSALVDSTPLPVCRIPSLAPHFGKPAEGPFDKEDQTIPVIGFPTPDEEGNE
PPTDDEKKSPLFGKHCIHLLRYVAKLAGVEVSELIQMDLDLFDVQKGTIGGIGKHFLFAP
RLDDRLCSFAAMIALICYAKDVNTEESDLFSTVTLYDNEEIGSLTRQGAKGGLLESVVER
SSSAFTKKPVDLHTVWANSIILSADVNHLYNPNFPEVYLKNHFPVPNVGITLSLDPNGHM
ATDVVGTALVEELARRNGDKVQYFQIKNNSRSGGTIGPSLASQTGARTIDLGIAQLSMHS
IRAATGSKDVGLGVKFFNGFFKHWRSVYDEFGEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM66023
NameBDBM66023
Synonyms:2-octyl-1,2-thiazol-3-one | 2-octyl-3-isothiazolone | 2-octyl-4-isothiazolin-3-one | MLS002415697 | SMR001370885 | cid_33528
TypeSmall organic molecule
Emp. Form.C11H19NOS
Mol. Mass.213.34
SMILESCCCCCCCCn1sccc1=O
Structure
n/a