BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetApelin receptor
LigandBDBM50058655
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of uHTS hits from a small molecule antagonists of the APJ receptor via a luminescent beta-arrestin assay
IC50 2630±n/a nM
Citation PubChem, PC Dose Response confirmation of uHTS hits from a small molecule antagonists of the APJ receptor via a luminescent beta-arrestin assay PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Apelin receptor
Name:Apelin receptor
Synonyms:AGTRL1 | APJ | APLNR | Angiotensin receptor-like 1 | G-protein coupled receptor APJ | G-protein coupled receptor HG11
Type:Enzyme Catalytic Domain
Mol. Mass.:42664.06
Organism:Homo sapiens (Human)
Description:P35414
Residue:380
Sequence:
MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREK
RRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCL
TGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQ
CYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGL
RKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYV
NSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGK
GGEQMHEKSIPYSQETLVVD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50058655
NameBDBM50058655
Synonyms:1,1',1'',1'''-[disulfanediylbis(carbonothioylnitrilo)]tetraethane | 1,1'-dithiobis(N,N-diethylthioformamide) | Antabuse (TN) | CHEMBL964 | DISULFIRAM | N,N,N',N'-tetraethylthiuram disulfide | N,N-diethyl[(diethylcarbamothioyl)disulfanyl]carbothioamide (G5) | bis(diethylthiocarbamoyl) disulfide | cid_3117 | tetraethylthioperoxydicarbonic diamide | tetraethylthiuram disulfide | tetraethylthiuram disulphide
TypeSmall organic molecule
Emp. Form.C10H20N2S4
Mol. Mass.296.539
SMILESCCN(CC)C(=S)SSC(=S)N(CC)CC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a