Reaction Details |
 | Report a problem with these data |
Target | DNA damage-inducible transcript 3 protein |
---|
Ligand | BDBM67779 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose-response primary assay and counterscreen assay for HTS small molecule inhibitors of CHOP to regulate the unfolded protein response to ER stress |
---|
IC50 | 4780±n/a nM |
---|
Citation | PubChem, PC Dose-response primary assay and counterscreen assay for HTS small molecule inhibitors of CHOP to regulate the unfolded protein response to ER stress PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
DNA damage-inducible transcript 3 protein |
---|
Name: | DNA damage-inducible transcript 3 protein |
Synonyms: | n/a |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 19175.17 |
Organism: | Mus musculus |
Description: | gi_160707929 |
Residue: | 168 |
Sequence: | MAAESLPFTLETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASL
AWLTEEPGPTEVTRTSQSPRSPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRMK
EKEQENERKVAQLAEENERLKQEIERLTREVETTRRALIDRMVSLHQA
|
|
|
BDBM67779 |
---|
Name | BDBM67779 |
Synonyms: | (6Z)-4-chloranyl-6-(5-phenyl-1,2-dihydropyrazol-3-ylidene)cyclohexa-2,4-dien-1-one | (6Z)-4-chloro-6-(5-phenyl-1,2-dihydropyrazol-3-ylidene)-1-cyclohexa-2,4-dienone | (6Z)-4-chloro-6-(5-phenyl-1,2-dihydropyrazol-3-ylidene)cyclohexa-2,4-dien-1-one | (6Z)-4-chloro-6-(5-phenyl-3-pyrazolin-3-ylidene)cyclohexa-2,4-dien-1-one | MLS000114270 | SMR000091684 | cid_5339816 |
Type | Small organic molecule |
Emp. Form. | C15H11ClN2O |
Mol. Mass. | 270.714 |
SMILES | Oc1ccc(Cl)cc1-c1cc([nH]n1)-c1ccccc1 |
Structure |  |
n/a |
---|