BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA damage-inducible transcript 3 protein
LigandBDBM67779
Substrate/Competitorn/a
Meas. Tech.Dose-response primary assay and counterscreen assay for HTS small molecule inhibitors of CHOP to regulate the unfolded protein response to ER stress
IC50 4780±n/a nM
Citation PubChem, PC Dose-response primary assay and counterscreen assay for HTS small molecule inhibitors of CHOP to regulate the unfolded protein response to ER stress PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
DNA damage-inducible transcript 3 protein
Name:DNA damage-inducible transcript 3 protein
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:19175.17
Organism:Mus musculus
Description:gi_160707929
Residue:168
Sequence:
MAAESLPFTLETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASL
AWLTEEPGPTEVTRTSQSPRSPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRMK
EKEQENERKVAQLAEENERLKQEIERLTREVETTRRALIDRMVSLHQA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM67779
NameBDBM67779
Synonyms:(6Z)-4-chloranyl-6-(5-phenyl-1,2-dihydropyrazol-3-ylidene)cyclohexa-2,4-dien-1-one | (6Z)-4-chloro-6-(5-phenyl-1,2-dihydropyrazol-3-ylidene)-1-cyclohexa-2,4-dienone | (6Z)-4-chloro-6-(5-phenyl-1,2-dihydropyrazol-3-ylidene)cyclohexa-2,4-dien-1-one | (6Z)-4-chloro-6-(5-phenyl-3-pyrazolin-3-ylidene)cyclohexa-2,4-dien-1-one | MLS000114270 | SMR000091684 | cid_5339816
TypeSmall organic molecule
Emp. Form.C15H11ClN2O
Mol. Mass.270.714
SMILESOc1ccc(Cl)cc1-c1cc([nH]n1)-c1ccccc1
Structure
n/a