BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlycogen synthase kinase-3 beta
LigandBDBM69052
Substrate/Competitorn/a
Meas. Tech.Luminescence Cell-Free Homogeneous Dose Retest to Identify Inhibitors of Glycogen Synthase Kinase-3 beta Activity
EC50>300000±n/a nM
Citation PubChem, PC Luminescence Cell-Free Homogeneous Dose Retest to Identify Inhibitors of Glycogen Synthase Kinase-3 beta Activity PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Glycogen synthase kinase-3 beta
Name:Glycogen synthase kinase-3 beta
Synonyms:GSK-3 beta | GSK-3, beta | Glycogen synthase kinase 3 beta (GSK3B) | Glycogen synthase kinase 3-beta (GSK3B) | Glycogen synthase kinase-3 beta (GSK-3B) | Glycogen synthase kinase-3 beta (GSK3 Beta) | Glycogen synthase kinase-3 beta (GSK3B) | Glycogen synthase kinase-3B (GSK-3B) | Glycogen synthase kinase-3beta (GSK3B) | Serine/threonine-protein kinase GSK3B
Type:Enzyme
Mol. Mass.:46756.38
Organism:Homo sapiens (Human)
Description:P49841
Residue:420
Sequence:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM69052
NameBDBM69052
Synonyms:2-(4-besylpiperazino)-N-(4-nitrophenyl)acetamide | 2-[4-(benzenesulfonyl)-1-piperazinyl]-N-(4-nitrophenyl)acetamide | 2-[4-(benzenesulfonyl)piperazin-1-yl]-N-(4-nitrophenyl)acetamide | MLS000394331 | N-(4-nitrophenyl)-2-[4-(phenylsulfonyl)piperazin-1-yl]ethanamide | SMR000248279 | cid_15945386
TypeSmall organic molecule
Emp. Form.C18H20N4O5S
Mol. Mass.404.44
SMILES[O-][N+](=O)c1ccc(NC(=O)CN2CCN(CC2)S(=O)(=O)c2ccccc2)cc1
Structure
n/a