BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetneuronal munc18-1 binding protein
LigandBDBM71561
Substrate/Competitorn/a
Meas. Tech.SAR analysis of small molecule inhibitors of Mint-PDZ and N-type Ca2+ channel carboxyl-terminal peptide association using HTRF - Set 2
IC50>56800±n/a nM
Citation PubChem, PC SAR analysis of small molecule inhibitors of Mint-PDZ and N-type Ca2+ channel carboxyl-terminal peptide association using HTRF - Set 2 PubChem Bioassay(2010)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
neuronal munc18-1 binding protein
Name:neuronal munc18-1 binding protein
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:92603.32
Organism:Rattus norvegicus
Description:gi_2625023
Residue:839
Sequence:
MNHLEGSAEVEVADEAPGGEVNESVEADLEHPEVEEEQQPSPPPPAGHAPEDHRAHPAPP
PPPPPQEEEEERGECLARSASTESGFHNHTDTAEGDVLAAARDGYEAERAQDADDESAYA
VQYRPEAEEYTEQAEAEHAEAAQRRALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRAE
DEPYAEPYADYGGLQEHVYEEIGDAPELEARDGLRLYERERDEAAAYRQEALGARLHHYD
ERSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEAEQD
LERAPTPGGGHPDSPGLPAPAGQQQRVVGTPGGSEVGQRYSKEKRDAISLAIKDIKEAIE
EVKTRTIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPVDGDSPSPGSSSPLGAESSITP
LHPGDPTEASTNKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKTPS
KNVRMMQAQEAVSRIKTAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQEPMM
DHPLRTISYIADIGNIVVLMARRRMPRSNSQENVEASHPSQDAKRQYKMICHVFESEDAQ
LIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYNDDLIHFSKSENCKDVF
IEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLP
LSTCQSIIKGLKNQSRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGGIAE
RGGVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPVYI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM71561
NameBDBM71561
Synonyms:VU0410201-1 | [2-(2-furanyl)-4-quinolinyl]-[4-(4-morpholinyl)-1-piperidinyl]methanone;2,2,2-trifluoroacetic acid | [2-(2-furyl)-4-quinolyl]-(4-morpholinopiperidino)methanone;2,2,2-trifluoroacetic acid | [2-(furan-2-yl)quinolin-4-yl]-(4-morpholin-4-ylpiperidin-1-yl)methanone;2,2,2-trifluoroacetic acid | [2-(furan-2-yl)quinolin-4-yl]-(4-morpholin-4-ylpiperidin-1-yl)methanone;2,2,2-tris(fluoranyl)ethanoic acid | cid_44631807
TypeSmall organic molecule
Emp. Form.C23H25N3O3
Mol. Mass.391.4629
SMILESO=C(N1CCC(CC1)N1CCOCC1)c1cc(nc2ccccc12)-c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a