BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAryl hydrocarbon receptor
LigandBDBM57731
Substrate/Competitorn/a
Meas. Tech.Luminescence-based cell-based high throughput dose response assay for activators of the Aryl Hydrocarbon Receptor (AHR)
EC50 3653±n/a nM
Citation PubChem, PC Luminescence-based cell-based high throughput dose response assay for activators of the Aryl Hydrocarbon Receptor (AHR) PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Aryl hydrocarbon receptor
Name:Aryl hydrocarbon receptor
Synonyms:AhR | Class E basic helix-loop-helix protein 76 | aryl hydrocarbon receptor precursor | bHLHe76
Type:PROTEIN
Mol. Mass.:96143.77
Organism:Homo sapiens (Human)
Description:ChEMBL_1503828
Residue:848
Sequence:
MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDV
INKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQ
ALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNP
SQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQ
GKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC
DAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRW
TWVQSNARLLYKNGRPDYIIVTQRPLTDEEGTEHLRKRNTKLPFMFTTGEAVLYEATNPF
PAIMDPLPLRTKNGTSGKDSATTSTLSKDSLNPSSLLAAMMQQDESIYLYPASSTSSTAP
FENNFFNESMNECRNWQDNTAPMGNDTILKHEQIDQPQDVNSFAGGHPGLFQDSKNSDLY
SIMKNLGIDFEDIRHMQNEKFFRNDFSGEVDFRDIDLTDEILTYVQDSLSKSPFIPSDYQ
QQQSLALNSSCMVQEHLHLEQQQQHHQKQVVVEPQQQLCQKMKHMQVNGMFENWNSNQFV
PFNCPQQDPQQYNVFTDLHGISQEFPYKSEMDSMPYTQNFISCNQPVLPQHSKCTELDYP
MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQH
THVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSEARPFP
DLTSSGFL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM57731
NameBDBM57731
Synonyms:MLS000662692 | N-(2,4-dimethylphenyl)-1H-benzimidazole-2-carbothioamide | SMR000270136 | cid_1328006
TypeSmall organic molecule
Emp. Form.C16H15N3S
Mol. Mass.281.375
SMILESCc1ccc(NC(=S)c2nc3ccccc3[nH]2)c(C)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a