BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMEP2
LigandBDBM34183
Substrate/Competitorn/a
Meas. Tech.Confirmatory Cherry Pick 3 SAR Dose Response Multiplex in TOR pathway GFP-fusion proteins for Saccharomyes cerevisiae, specifically MEP2
EC50 68170±n/a nM
Citation PubChem, PC Confirmatory Cherry Pick 3 SAR Dose Response Multiplex in TOR pathway GFP-fusion proteins for Saccharomyes cerevisiae, specifically MEP2 PubChem Bioassay(2011)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
MEP2
Name:MEP2
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:53401.07
Organism:Saccharomyces cerevisiae
Description:gi_1302091
Residue:499
Sequence:
MSYNFTGTPTGEGTGGNSLTTDLNTQFDLANMGWIGVASAGVWIMVPGIGLLYSGLSRKK
HALSLLWASMMASAVCIFQWFFWGYSLAFSHNTRGNGFIGTLEFFGFRNVLGAPSSVSSL
PDILFAVYQGMFAAVTGALMLGGACERARLFPMMVFLFLWMTIVYCPIACWVWNAEGWLV
KLGSLDYAGGLCVHLTSGHGGLVYALILGKRNDPVTRKGMPKYKPHSVTSVVLGTVFLWF
GWMFFNGGSAGNATIRAWYSIMSTNLAAACGGLTWMVIDYFRCGRKWTTVGLCSGIIAGL
VGITPAAGFVPIWSAVVIGVVTGAGCNLAVDLKSLLRIDDGLDCYSIHGVGGCIGSVLTG
IFAADYVNATAGSYISPIDGGWINHHYKQVGYQLAGICAALAWTVTVTSILLLTMNAIPF
LKLRLSADEEELGTDAAQIGEFTYEESTAYIPEPIRSKTSAQMPPPHENIDDKIVGNTDA
EKNSTPSDASSTKNTDHIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM34183
NameBDBM34183
Synonyms:2-[4-phenyl-6-(trifluoromethyl)pyrimidin-2-yl]sulfonylacetic acid ethyl ester | 2-[[4-phenyl-6-(trifluoromethyl)-2-pyrimidinyl]sulfonyl]acetic acid ethyl ester | MLS000049112 | SMR000074423 | cid_1151859 | ethyl 2-[4-phenyl-6-(trifluoromethyl)pyrimidin-2-yl]sulfonylacetate | ethyl 2-[4-phenyl-6-(trifluoromethyl)pyrimidin-2-yl]sulfonylethanoate | ethyl {[4-phenyl-6-(trifluoromethyl)-2-pyrimidinyl]sulfonyl}acetate
TypeSmall organic molecule
Emp. Form.C15H13F3N2O4S
Mol. Mass.374.335
SMILESCCOC(=O)CS(=O)(=O)c1nc(cc(n1)C(F)(F)F)-c1ccccc1
Structure
n/a