BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMEP2
LigandBDBM32188
Substrate/Competitorn/a
Meas. Tech.Confirmatory Cherry Pick 3 SAR Dose Response Multiplex in TOR pathway GFP-fusion proteins for Saccharomyes cerevisiae, specifically MEP2
EC50 337300000±n/a nM
Citation PubChem, PC Confirmatory Cherry Pick 3 SAR Dose Response Multiplex in TOR pathway GFP-fusion proteins for Saccharomyes cerevisiae, specifically MEP2 PubChem Bioassay(2011)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
MEP2
Name:MEP2
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:53401.07
Organism:Saccharomyces cerevisiae
Description:gi_1302091
Residue:499
Sequence:
MSYNFTGTPTGEGTGGNSLTTDLNTQFDLANMGWIGVASAGVWIMVPGIGLLYSGLSRKK
HALSLLWASMMASAVCIFQWFFWGYSLAFSHNTRGNGFIGTLEFFGFRNVLGAPSSVSSL
PDILFAVYQGMFAAVTGALMLGGACERARLFPMMVFLFLWMTIVYCPIACWVWNAEGWLV
KLGSLDYAGGLCVHLTSGHGGLVYALILGKRNDPVTRKGMPKYKPHSVTSVVLGTVFLWF
GWMFFNGGSAGNATIRAWYSIMSTNLAAACGGLTWMVIDYFRCGRKWTTVGLCSGIIAGL
VGITPAAGFVPIWSAVVIGVVTGAGCNLAVDLKSLLRIDDGLDCYSIHGVGGCIGSVLTG
IFAADYVNATAGSYISPIDGGWINHHYKQVGYQLAGICAALAWTVTVTSILLLTMNAIPF
LKLRLSADEEELGTDAAQIGEFTYEESTAYIPEPIRSKTSAQMPPPHENIDDKIVGNTDA
EKNSTPSDASSTKNTDHIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32188
NameBDBM32188
Synonyms:CLIOQUINOL | Clioquinol (CQ) | TG2-36-2 | cid_2788
TypeSmall organic molecule
Emp. Form.C9H5ClINO
Mol. Mass.305.5
SMILESOc1c(I)cc(Cl)c2cccnc12
Structure
n/a